
SimulationCraft 510-11

for World of Warcraft 5.2.0 PTR (build level 16577)

Table of Contents

Raid Summary


DPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Warrior_Arms_T15H 3.93 0.13 - - - - 1.75 5.29 - 7.97 - 2.12 2.32 1.80 11.97 - - - - - wowhead lootrank
Warrior_Fury_1h_T15H 4.51 0.14 - - - - 2.10 6.97 - 2.26 2.38 3.39 2.87 3.16 10.04 5.74 - - - - wowhead lootrank
Warrior_Fury_2h_T14H 3.67 0.16 - - - - 1.75 7.08 - 4.56 1.91 3.18 2.29 2.96 8.84 3.79 - - - - wowhead lootrank

Warrior_Arms_T15H : 174646 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
174645.9 174645.9 101.57 / 0.06% 8548 / 4.9% 20358.2 8.6 8.6 Rage 0.27% 57.9 100.0% 100%
  • Glyph of Unending Rage
  • Glyph of Death From Above
  • engineering: 600
  • blacksmithing: 600
Scale Factors for Warrior_Arms_T15H Damage Per Second
Str Agi AP Exp Hit Crit Haste Mastery Wdps
Scale Factors 3.93 0.13 1.75 5.29 7.97 2.12 2.32 1.80 11.97
Normalized 1.00 0.03 0.45 1.34 2.03 0.54 0.59 0.46 3.04
Scale Deltas 1000 1000 1000 -1000 -1000 1000 1000 1000 300
Error 0.14 0.14 0.14 0.15 0.33 0.14 0.14 0.14 0.48
Gear Ranking
  • Wdps > Hit > Exp > Str > Haste > Crit > Mastery ~= AP > Agi
Pawn string
  • ( Pawn: v1: "Warrior_Arms_T15H": Strength=3.93, Agility=0.13, Ap=1.75, ExpertiseRating=5.29, HitRating=7.97, CritRating=2.12, HasteRating=2.32, MasteryRating=1.80, MeleeDps=11.97 )
Zero hit/exp
  • ( Pawn: v1: "Warrior_Arms_T15H": Strength=3.93, Agility=0.13, Ap=1.75, ExpertiseRating=0.00, HitRating=0.00, CritRating=2.12, HasteRating=2.32, MasteryRating=1.80, MeleeDps=11.97 )

Charts,s,333333&chd=t:270722|134829|92295|81816|75123|74075|68309|23275&chds=0,541445&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++270722++execute,C79C6E,0,0,15|t++134829++dragon_roar,C79C6E,1,0,15|t++92295++overpower,C79C6E,2,0,15|t++81816++impending_victory,C79C6E,3,0,15|t++75123++slam,C79C6E,4,0,15|t++74075++mortal_strike,C79C6E,5,0,15|t++68309++colossus_smash,C79C6E,6,0,15|t++23275++melee_main_hand,C79C6E,7,0,15&chtt=Warrior_Arms_T15H Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:19,13,13,10,9,9,5,5,5,4,3,2,2,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600&chl=overpower|melee_main_hand|mortal_strike|execute|deep_wounds|opportunity_strike|colossus_smash|heroic_strike|bloodbath|lightning_strike|slam|impending_victory|dragon_roar|heroic_leap|stormlash&chtt=Warrior_Arms_T15H Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:11.97,7.97,5.29,3.93,2.32,2.12,1.80,1.75,0.13|11.49,7.64,5.14,3.79,2.17,1.98,1.66,1.61,-0.01|12.46,8.30,5.43,4.08,2.46,2.27,1.95,1.90,0.27&chco=C79C6E&chm=E,FF0000,1:0,,1:20|t++++11.97++Wdps,C79C6E,0,0,15,0.1,e|t++++7.97++Hit,C79C6E,0,1,15,0.1,e|t++++5.29++Exp,C79C6E,0,2,15,0.1,e|t++++3.93++Str,C79C6E,0,3,15,0.1,e|t++++2.32++Haste,C79C6E,0,4,15,0.1,e|t++++2.12++Crit,C79C6E,0,5,15,0.1,e|t++++1.80++Mastery,C79C6E,0,6,15,0.1,e|t++++1.75++AP,C79C6E,0,7,15,0.1,e|t++++0.13++Agi,C79C6E,0,8,15,0.1,e&chds=-0.025,14.378&chtt=Scale Factors|Warrior_Arms_T15H%20Damage%20Per%20Second&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:022224424343457864421zxwvurrqonmnlkihihggffeeffededfdddeeedffefgghghihiihiighgggfffdeedeccdcdcbdddccddccdcdccdccccddcddeeefgeggghghhghhghhfgfffeefdedcdcdddddcddcccddcddcccddcdddfffhhjkkmmmoppqqrssssrrqoomnmjkkiihggffedddcddddcdccddccdddddedeeeffggfhggggggfggfffefedededcddcddcdcddcddcddddcddcddcdeefefgghhhiijjjkkjklkkjkkjjjijihihhhhhhghhghghhhhhhhhhhhiihijjlmopprstuvvxxz0z12121zzxxwuutssrppoonmmlkllklkllkllklllmlmnmoooppqqqrssttststtsssrrrqrpqqpppoppopopqpqqpqqpqpqppppopqqqpqqqrrrssststtstsrsrrrpqpooonnmmmllmllllmllmllmlllklkllllmlnopqrtuuwxxz1111233576654&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5964,0.4&chxt=x,y&chxl=0:|0|sec=561|1:|0|avg=174646|max=292812&chxp=1,1,60,100&chtt=Warrior_Arms_T15H DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,4,3,4,7,32,48,59,78,132,201,216,295,384,472,517,592,618,640,638,653,604,580,533,468,423,320,321,260,203,147,157,88,74,62,54,30,17,20,10,7,7,4,1,1,1,1,1,0,1&chds=0,653&chbh=5&chxt=x&chxl=0:|min=157672|avg=174646|max=199295&chxp=0,1,41,100&chtt=Warrior_Arms_T15H DPS Distribution&chts=dddddd,18,s,333333&chd=t:36.5,29.5,13.7,7.0,6.7,3.6,2.1,0.9,0.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=overpower 164.8s|mortal_strike 133.0s|colossus_smash 61.9s|slam 31.5s|execute 30.0s|impending_victory 16.1s|dragon_roar 9.4s|battle_shout 4.2s|waiting 1.2s&chtt=Warrior_Arms_T15H Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Arms_T15H 174646
battle_shout 0 0.0% 2.8 110.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 2.76 0.00 0.00 1.5364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<90
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by {$s1=10}%. Lasts {$d=300 seconds}. Generates ${{$92049m1=200}/10} Rage.
berserker_rage 0 0.0% 13.2 35.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.17 13.17 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.enrage.up
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 7908 4.5% 8.0 60.20sec 444241 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.9 26178 0 26178 0.0% 0.0% 30.1%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.01 133.29 135.86 135.86 0.0000 1.0000 3556288.12 3556288.12 0.00 26175.35 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.29 93.99% 0.00 0 0 0.00 0 0 0 0 0.00
none 8.01 6.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.9 100.00% 26178.47 873 137506 26225.15 19707 37394 3556288 3556288 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every {$t1=1} sec. Movement slowed by {$s2=50}%.
  • description:Your target bleeds for an additional {$12292s1=30}% damage of the triggering attack over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:13480.26
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
colossus_smash 9391 5.4% 40.3 11.26sec 104955 68309 70434 148684 104958 44.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.30 40.30 0.00 0.00 1.5365 0.0000 4229869.83 4229869.83 0.00 68308.54 68308.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.52 55.88% 70434.05 54196 111031 70319.73 59635 83537 1586214 1586214 0.00
crit 17.78 44.12% 148684.37 108391 266474 148470.42 121876 181999 2643656 2643656 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.remains<=1.5
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for {$s3=2}% weapon damage plus {$s1=222} and weakens their defenses, allowing your attacks to bypass {$s2=100}% of their armor for {$s4=6} sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.{$?s89003=false}[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by {$113746s1=4}% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by {$81326s1=4}% for {$81326d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deep_wounds 15304 8.8% 86.5 5.24sec 79689 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.9 30757 65831 46013 43.5% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.54 86.54 149.89 149.89 0.0000 3.0000 6896595.30 6896595.30 0.00 15337.42 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.7 56.50% 30756.82 25052 49201 30762.65 28788 33525 2604891 2604891 0.00
crit 65.2 43.50% 65831.06 50105 118083 65906.34 61124 72892 4291705 4291705 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for {$s1=218} every {$t1=3} sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.480000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 2807 1.6% 6.1 65.91sec 207166 134829 0 207161 207161 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 6.10 0.00 0.00 1.5365 0.0000 1262938.93 1262938.93 0.00 134828.54 134828.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 6.10 100.00% 207160.55 147792 487674 207403.69 160494 287057 1262939 1262939 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar ferociously, causing {$?s12712=false}[${{$m1=126}*1.2}][{$m1=126}] damage to all enemies within $A1 yards, knocking them back and knocking them down for {$118895d=500 milliseconds}. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 18087 10.3% 19.5 3.48sec 415958 270722 261159 573690 415972 49.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.54 19.54 0.00 0.00 1.5365 0.0000 8128709.90 8128709.90 0.00 270722.37 270722.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.86 50.47% 261159.38 166645 472825 261529.63 172200 428248 2575839 2575839 0.00
crit 9.68 49.53% 573690.24 333291 1134780 576244.52 404671 951934 5552871 5552871 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing {$?s12712=false}[${{$m1=1}*1.2}][{$m1=1}] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.000000
  • base_dd_min:8100.94
  • base_dd_max:8100.94
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 1787 1.0% 14.1 33.14sec 57204 0 38313 80996 57202 44.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 14.07 0.00 0.00 0.0000 0.0000 804594.61 804594.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.84 55.74% 38312.96 31033 61191 38311.56 32940 46655 300375 300375 0.00
crit 6.23 44.26% 80996.19 62067 146859 81217.75 0 111444 504219 504219 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*{$52174m1=1}}][{$52174m1=1}] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 8090 4.6% 42.7 8.77sec 85322 0 57152 121976 85319 43.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.70 42.70 0.00 0.00 0.0000 0.0000 3643318.19 3643318.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.15 56.55% 57152.42 34335 68501 57145.60 53629 60453 1379963 1379963 0.00
crit 18.56 43.45% 121975.89 68670 168544 122043.49 108538 135724 2263355 2263355 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ptr&&(((debuff.colossus_smash.up&rage>=70))&>=20)|rage>=110
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:An attack that instantly deals {$m2=110}% weapon damage plus {$m1=1} (${{$m2=110}*1.40}% plus ${{$m1=1}*1.40} if a one-handed weapon is equipped){$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
impending_victory 2925 1.7% 10.5 35.97sec 125706 81816 85593 182031 125703 41.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.49 10.49 0.00 0.00 1.5365 0.0000 1318541.68 1318541.68 0.00 81815.69 81815.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.13 58.41% 85592.60 68882 153232 85648.12 68882 123713 524368 524368 0.00
crit 4.36 41.59% 182030.77 137763 384742 181379.86 0 356392 794173 794173 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&>=20
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:
  • description:Instantly attack the target causing {$?s12712=false}[${1.2*{$m2=56}}][{$m2=56}] damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.560000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory_heal 0 0.0% 10.5 35.97sec 0 0 0 0 0 34.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.49 10.49 0.00 0.00 0.0000 0.0000 0.00 573855.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.89 65.70% 0.00 0 0 0.00 0 0 0 377011 100.00
crit 3.60 34.30% 0.00 0 0 0.00 0 0 0 196844 98.36
HPS Timeline Chart

Action details: impending_victory_heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T15H
  • harmful:true
  • if_expr:
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:
  • description:{$@spelldesc103840=Instantly attack the target causing {$?s12712=false}[${1.2*{$m2=56}}][{$m2=56}] damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.}
lightning_strike 7445 4.3% 53.6 8.34sec 62598 0 45187 93020 62599 36.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.61 53.61 0.00 0.00 0.0000 0.0000 3355802.59 3355802.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.10 63.60% 45187.01 39457 70496 45201.11 41629 50015 1540662 1540662 0.00
crit 19.51 36.40% 93020.11 78914 169192 93066.69 81911 108246 1815140 1815140 0.00
DPS Timeline Chart

Action details: lightning_strike

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.750000
  • base_dd_min:280.00
  • base_dd_max:280.00
melee_main_hand 23268 13.3% 168.8 2.66sec 62094 23275 44396 93696 62094 41.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.83 168.83 0.00 0.00 2.6679 0.0000 10483159.61 10483159.61 0.00 23274.86 23274.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.68 34.75% 44395.96 31714 65860 44411.14 39215 49429 2604946 2604946 0.00
crit 69.64 41.25% 93696.01 63428 158065 93773.77 83921 104962 6524559 6524559 0.00
glance 40.52 24.00% 33410.39 23785 49395 33419.75 28738 37737 1353654 1353654 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 21858 12.5% 86.5 5.24sec 113816 74075 76599 162419 113816 43.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.54 86.54 0.00 0.00 1.5365 0.0000 9850067.41 9850067.41 0.00 74075.14 74075.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.01 56.63% 76598.97 56230 114327 76624.37 69373 85620 3754446 3754446 0.00
crit 37.53 43.37% 162419.50 112461 274384 162547.76 141891 188453 6095621 6095621 0.00
DPS Timeline Chart

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:Healing effects on you are increased by {$s5=10}%
  • description:A vicious strike that deals {$m3=175}% weapon damage plus {$s2=1539 + 100.0%} and causes Mortal Wounds on the target. Generates 10 Rage.{$?s58368=false}[ When your Mortal Strike is affecting a target, healing effects on you are increased by {$s5=10}%. ][] |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1539.18
  • base_dd_max:1539.18
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
opportunity_strike 15269 8.7% 196.6 2.29sec 34982 0 23515 50047 34981 43.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.64 196.64 0.00 0.00 0.0000 0.0000 6878995.60 6878995.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.66 56.78% 23515.17 16925 34721 23517.36 21293 25737 2625613 2625613 0.00
crit 84.99 43.22% 50046.56 33850 83330 50075.95 44183 56190 4253382 4253382 0.00
DPS Timeline Chart

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:76858
  • name:Opportunity Strike
  • school:physical
  • tooltip:
  • description:Deals {$s2=1}% main hand weapon damage.
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.55
overpower 33722 19.3% 159.0 2.81sec 95663 92295 46914 97495 95662 96.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 158.96 158.96 0.00 0.00 1.0365 0.0000 15206538.91 15206538.91 0.00 92294.53 92294.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.76 3.62% 46913.59 33299 69153 46703.70 0 63782 270142 270142 0.00
crit 153.20 96.38% 97494.94 66599 165968 97529.65 90834 105313 14936397 14936397 0.00
DPS Timeline Chart

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:7384
  • name:Overpower
  • school:physical
  • tooltip:
  • description:Instantly overpower the enemy causing {$m1=105}% weapon damage. Cannot be blocked, dodged or parried. Overpower has a {$s3=60}% increased chance to be a critical strike. Overpower is activated by Taste for Blood.
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
recklessness 0 0.0% 2.0 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional {$s1=50}% chance to critically hit. Lasts {$d=12 seconds}.
slam 5235 3.0% 20.5 17.31sec 115425 75123 80379 167334 115428 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.48 20.48 0.00 0.00 1.5365 0.0000 2364255.74 2364255.74 0.00 75122.51 75122.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.23 59.70% 80379.18 69637 134825 80417.99 71620 103672 982877 982877 0.00
crit 8.26 40.30% 167334.31 139274 323581 167305.73 0 270699 1381379 1381379 0.00
DPS Timeline Chart

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:rage>=40&>=20
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams the opponent, causing {$1464m2=220}% weapon damage plus {$1464m1=1}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:997.04
  • base_dd_max:997.04
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20
stormlash 1551 0.9% 47.3 6.92sec 14542 0 10575 23400 14542 30.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.32 47.32 0.00 0.00 0.0000 0.0000 688086.65 688086.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.68 69.07% 10575.26 5784 18720 10576.79 8801 13611 345615 345615 0.00
crit 14.64 30.93% 23399.87 11569 42807 23401.36 16304 32169 342472 342472 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5952.18
  • base_dd_max:5952.18


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 13.2 0.0 35.6sec 35.5sec 17.40% 17.40%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:17.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
bloodbath 8.0 0.0 60.2sec 60.2sec 21.02% 21.08%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:21.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, causes your melee special attacks to deal an additional {$12292s1=30}% damage as a bleed over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.34%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 12.0 8.3 37.0sec 21.3sec 41.83% 41.36%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:41.83%

    Trigger Attempt Success

    • trigger_pct:99.69%
enrage 29.8 54.8 15.4sec 5.4sec 76.90% 78.33%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:76.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by {$s2=10}%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:{$@spelldesc13046=Mortal Strike, Bloodthirst and Colossus Smash critical strikes and critical blocks Enrage you, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
gaze_of_the_twins 5.8 2.5 70.2sec 46.6sec 30.56% 30.56%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_gaze_of_the_twins
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3238.00

    Stack Uptimes

    • gaze_of_the_twins_1:21.33%
    • gaze_of_the_twins_2:6.37%
    • gaze_of_the_twins_3:2.86%

    Trigger Attempt Success

    • trigger_pct:99.82%
mogu_power_potion 1.0 0.0 388.3sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:4000.03

    Stack Uptimes

    • mogu_power_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105706
  • name:Potion of Mogu Power
  • tooltip:Strength increased by {$s1=4000}.
  • description:Increases your Strength by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
primordius_talisman_of_rage 15.9 14.3 28.1sec 14.5sec 49.68% 49.68%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_primordius_talisman_of_rage
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1736.00

    Stack Uptimes

    • primordius_talisman_of_rage_1:26.12%
    • primordius_talisman_of_rage_2:12.31%
    • primordius_talisman_of_rage_3:5.90%
    • primordius_talisman_of_rage_4:2.80%
    • primordius_talisman_of_rage_5:2.55%

    Trigger Attempt Success

    • trigger_pct:99.63%
recklessness 2.0 0.0 387.5sec 0.0sec 5.41% 5.33%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • recklessness_1:5.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional {$s1=50}% chance to critically hit. Lasts {$d=12 seconds}.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
skull_banner 5.9 0.0 75.3sec 75.3sec 12.95% 16.08%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
synapse_springs_2 8.0 0.0 60.2sec 60.2sec 17.57% 17.57%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.57%

    Trigger Attempt Success

    • trigger_pct:100.00%
taste_for_blood 75.1 11.4 5.2sec 5.2sec 66.63% 66.63%

Buff details

  • buff initial source:Warrior_Arms_T15H
  • cooldown name:buff_taste_for_blood
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • taste_for_blood_1:19.87%
  • taste_for_blood_2:33.31%
  • taste_for_blood_3:1.42%
  • taste_for_blood_4:2.98%
  • taste_for_blood_5:9.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:60503
  • name:Taste for Blood
  • tooltip:Mortal Strike or target dodges enable the use of Overpower.
  • description:{$@spelldesc56636=Your Mortal Strike hits grant {$56636s2=2} uses of Overpower. When your target dodges any of your attacks you gain {$56636s1=1} use of Overpower. This effect stacks up to {$60503s1=5} times and lasts {$60503d=12 seconds}.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs


Resource Usage Type Count Total Average RPE APR
execute Rage 19.5 586.4 30.0 30.0 13861.6
heroic_strike Rage 42.7 1281.0 30.0 30.0 2844.2
impending_victory Rage 10.5 104.9 10.0 10.0 12571.1
overpower Rage 159.0 1482.3 9.3 9.3 10259.0
slam Rage 20.5 409.7 20.0 20.0 5771.3
Resource Gains Type Count Total Average Overflow
battle_shout Rage 2.76 55.14 (1.42%) 20.00 0.00 0.00%
enrage Rage 84.56 845.52 (21.72%) 10.00 0.10 0.01%
melee_main_hand Rage 168.83 2126.83 (54.63%) 12.60 0.38 0.02%
mortal_strike Rage 86.54 865.43 (22.23%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Rage 8.63 8.56
Combat End Resource Mean Min Max
Health 547097.00 547097.00 547097.00
Rage 28.04 0.20 81.80
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%


Count Interval
lightning_strike 53.6 8.3sec
strikes_of_opportunity 196.6 2.3sec
sudden_death 36.6 12.2sec
taste_for_blood_wasted 9.4 7.7sec
t15_2pc_melee 16.1 26.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9992
Mean 451.18
Minimum 342.27
Maximum 561.18
Spread ( max - min ) 218.91
Range [ ( max - min ) / 2 * 100% ] 24.26%
Distribution Chart


Sample Data Warrior_Arms_T15H Damage Per Second
Count 9992
Mean 174645.93
Minimum 157672.08
Maximum 199294.68
Spread ( max - min ) 41622.61
Range [ ( max - min ) / 2 * 100% ] 11.92%
Standard Deviation 5180.1395
5th Percentile 166557.30
95th Percentile 183652.42
( 95th Percentile - 5th Percentile ) 17095.12
Mean Distribution
Standard Deviation 51.8221
95.00% Confidence Intervall ( 174544.36 - 174747.50 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3379
0.1 Scale Factor Error with Delta=300 229069
0.05 Scale Factor Error with Delta=300 916276
0.01 Scale Factor Error with Delta=300 22906914
Distribution Chart


Sample Data
Count 9992
Mean 174645.93
Distribution Chart


Sample Data
Count 9992
Mean 78667763.08
Distribution Chart


Sample Data Warrior_Arms_T15H Damage Taken Per Second
Count 9992
Mean 0.00
Distribution Chart


Sample Data Warrior_Arms_T15H Healing Per Second
Count 9992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 9992
Mean 0.00
Distribution Chart


Sample Data
Count 9992
Mean 0.00
Distribution Chart


Sample Data Warrior_Arms_T15H Healing taken Per Second
Count 9992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 9992
Mean 435.12
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mogu_power_potion,if=(<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 2.00 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(>=20&target.time_to_die>195)|(<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 8.01 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 8.00 use_item,name=reinbinders_fists,use_off_gcd=1,if=!talent.bloodbath.enabled|(talent.bloodbath.enabled&buff.bloodbath.up)
B 13.17 berserker_rage,use_off_gcd=1,if=!buff.enrage.up
C 14.07 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
D 42.70 heroic_strike,use_off_gcd=1,if=ptr&&(((debuff.colossus_smash.up&rage>=70))&>=20)|rage>=110
E 86.54 mortal_strike
F 40.30 colossus_smash,if=debuff.colossus_smash.remains<=1.5
G 19.55 execute
H 158.95 overpower
I 0.00 storm_bolt,if=talent.storm_bolt.enabled
J 0.00 shockwave,if=talent.shockwave.enabled
K 6.10 dragon_roar,if=talent.dragon_roar.enabled
L 10.49 impending_victory,if=talent.impending_victory.enabled&>=20
M 20.48 slam,if=rage>=40&>=20
N 2.76 battle_shout,if=rage<90

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 22495 20059 18896
Agility 226 215 80
Stamina 28621 26019 25831
Intellect 121 115 80
Spirit 146 146 80
Health 547097 510669 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 16.70% 16.70% 3111
Spell Crit 32.08% 27.08% 15641
Spell Haste 18.63% 12.98% 5515
ManaReg per Second 0 0 0
Attack Power 49731 40338 0
Melee Hit 9.15% 9.15% 3111
Melee Crit 37.09% 32.09% 15641
Melee Haste 19.46% 19.46% 5515
Swing Speed 31.41% 19.46% 5515
Expertise 7.55% 7.55% 2568
Armor 37021 37021 37021
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.01% 5.01% 0
Tank-Parry 25.47% 23.25% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 40.33% 29.33% 3200


Source Slot Average Item Level: 535.00
Local Head helmet_of_the_last_mogu,id=96730,gems=capacitive_primal_320crit_180crit,reforge=hit_crit
Local Neck amulet_of_the_primal_turtle,id=96429,gems=160hit_160crit_60crit,reforge=hit_mastery
Local Shoulders pauldrons_of_the_last_mogu,id=96734,gems=160exp_160crit_320crit_120crit,enchant=200str_100crit,reforge=exp_crit
Shirt empty
Local Chest battleplate_of_the_last_mogu,id=96731,gems=160exp_160crit_320crit_160crit_160hit_180strength,enchant=80all,reforge=exp_crit
Local Waist abandoned_zandalari_goreplate,id=96719,gems=160crit_160hit_320crit_60str,reforge=hit_mastery
Local Legs legplates_of_the_last_mogu,id=96733,gems=320crit_160hit_160crit_120str,enchant=285str_165crit
Local Feet tidal_force_treads,id=96542,gems=160crit_160exp_60crit,enchant=140mastery
Local Wrists frozen_warlords_bracers,id=96394,gems=320crit,enchant=180str,reforge=exp_crit
Local Hands reinbinders_fists,id=96533,gems=320crit_160exp_160crit_160hit_160crit_120str,enchant=170str,addon=synapse_springs_mark_ii,reforge=haste_mastery
Local Finger1 spinescale_seal,id=96448,reforge=hit_mastery
Local Finger2 band_of_the_scaled_tyrant,id=96500,gems=160exp_160crit_60haste,reforge=hit_crit
Local Trinket1 primordius_talisman_of_rage,id=96501
Local Trinket2 gaze_of_the_twins,id=96543
Local Back hydrascale_bloodcloak,id=96499,gems=160hit_160crit_60str,enchant=180crit,reforge=exp_mastery
Local Main Hand greatsword_of_frozen_hells,id=96619,gems=320crit_60str,enchant=dancing_steel
Off Hand empty
Unknown empty
Tabard empty


15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt







# Gear Summary
# gear_strength=18896
# gear_agility=80
# gear_stamina=25831
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2568
# gear_hit_rating=3111
# gear_crit_rating=15641
# gear_haste_rating=5515
# gear_mastery_rating=3200
# gear_armor=37021
# meta_gem=capacitive_primal
# tier15_2pc_melee=1
# tier15_4pc_melee=1
# hands=reinbinders_fists,heroic=1,addon=synapse_springs_mark_ii
# main_hand=greatsword_of_frozen_hells,heroic=1,weapon=sword2h_3.60speed_18506min_27760max,enchant=dancing_steel

Warrior_Fury_1h_T15H : 185999 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
185999.2 185999.2 104.84 / 0.06% 8855 / 4.8% 17131.8 10.8 10.9 Rage 1.90% 61.6 100.0% 100%
  • Glyph of Unending Rage
  • Glyph of Death From Above
  • engineering: 600
  • blacksmithing: 600
Scale Factors for Warrior_Fury_1h_T15H Damage Per Second
Str Agi AP Exp Hit InvHit Crit Haste Mastery Wdps WOHdps
Scale Factors 4.51 0.14 2.10 6.97 2.26 2.38 3.39 2.87 3.16 10.04 5.74
Normalized 1.00 0.03 0.47 1.55 0.50 0.53 0.75 0.64 0.70 2.22 1.27
Scale Deltas 1000 1000 1000 -1000 -1000 1000 1000 1000 1000 300 300
Error 0.15 0.15 0.15 0.16 0.15 0.15 0.15 0.15 0.15 0.49 0.49
Gear Ranking
  • Wdps > Exp > WOHdps > Str > Crit > Mastery > Haste > InvHit ~= Hit > AP > Agi
Pawn string
  • ( Pawn: v1: "Warrior_Fury_1h_T15H": Strength=4.51, Agility=0.14, Ap=2.10, ExpertiseRating=6.97, HitRating=2.26, CritRating=3.39, HasteRating=2.87, MasteryRating=3.16, MeleeDps=10.04 )
Zero hit/exp
  • ( Pawn: v1: "Warrior_Fury_1h_T15H": Strength=4.51, Agility=0.14, Ap=2.10, ExpertiseRating=0.00, HitRating=0.00, CritRating=3.39, HasteRating=2.87, MasteryRating=3.16, MeleeDps=10.04 )

Charts,s,333333&chd=t:281747|157413|117837|70231|66178|48820|35925|25121|21173|13621&chds=0,563494&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++281747++execute,C79C6E,0,0,15|t++157413++dragon_roar,C79C6E,1,0,15|t++117837++raging_blow,C79C6E,2,0,15|t++70231++wild_strike,C79C6E,3,0,15|t++66178++impending_victory,C79C6E,4,0,15|t++48820++colossus_smash,C79C6E,5,0,15|t++35925++bloodthirst,C79C6E,6,0,15|t++25121++melee_main_hand,C79C6E,7,0,15|t++21173++melee_off_hand,C79C6E,8,0,15|t++13621++heroic_throw,C79C6E,9,0,15&chtt=Warrior_Fury_1h_T15H Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:14,12,12,10,10,8,7,6,5,5,5,2,2,1,1,1,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=melee_main_hand|execute|melee_off_hand|heroic_strike|raging_blow_mh|raging_blow_oh|deep_wounds|bloodthirst|wild_strike|lightning_strike|bloodbath|dragon_roar|colossus_smash|heroic_leap|impending_victory|stormlash|heroic_throw&chtt=Warrior_Fury_1h_T15H Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:10.04,6.97,5.74,4.51,3.39,3.16,2.87,2.38,2.26,2.10,0.14|9.55,6.82,5.25,4.36,3.25,3.01,2.73,2.24,2.11,1.95,-0.01|10.53,7.13,6.23,4.66,3.54,3.31,3.02,2.53,2.40,2.25,0.29&chco=C79C6E&chm=E,FF0000,1:0,,1:20|t++++10.04++Wdps,C79C6E,0,0,15,0.1,e|t++++6.97++Exp,C79C6E,0,1,15,0.1,e|t++++5.74++WOHdps,C79C6E,0,2,15,0.1,e|t++++4.51++Str,C79C6E,0,3,15,0.1,e|t++++3.39++Crit,C79C6E,0,4,15,0.1,e|t++++3.16++Mastery,C79C6E,0,5,15,0.1,e|t++++2.87++Haste,C79C6E,0,6,15,0.1,e|t++++2.38++InvHit,C79C6E,0,7,15,0.1,e|t++++2.26++Hit,C79C6E,0,8,15,0.1,e|t++++2.10++AP,C79C6E,0,9,15,0.1,e|t++++0.14++Agi,C79C6E,0,10,15,0.1,e&chds=-0.018,12.058&chtt=Scale Factors|Warrior_Fury_1h_T15H%20Damage%20Per%20Second&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:314323222213243485222zzwvvtsrqponnlkkgghgggggfffeeeddddccccccdeefffggghhhhhhiiihhhggfffeeeddddcccccbcbbbbbbbbcccbcccbccccccddeeffggghhhiiiiiihhhhggfffeeddddccccccccccccccccccccdddeeffghiijklnopqstuuuuuuttssrqponmlkjhggfeeedddcccccbbbbbbbbbbbbbbbccccccdddefffgghhhhiiiiiihhhgggffeeeddddcccccccccccccddddddeeeeeeffffgghhiijjkklllmmmmmmmmmllkkkjjjiiihhhgggggfgghijklmmnoopqrstuvxyzzzzzzzz00000000zzyxwvutssrqpoonmmllkkkjjjjjjjjjjjjkkkkkllllmmnnopqrstuwxyz01234455554432110zyxwvutsrrqppoonnmmmmmmmmmmmmmmmmnnnoppqrrstuvwxxyzz0000000zzyxxwvutttttttttsstssqqqqqqqqqqp&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6025,0.4&chxt=x,y&chxl=0:|0|sec=561|1:|0|avg=185999|max=308736&chxp=1,1,60,100&chtt=Warrior_Fury_1h_T15H DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,5,7,8,16,20,38,55,81,97,138,178,219,269,376,401,442,564,574,561,578,621,608,581,537,500,473,407,293,271,232,171,175,126,99,74,57,39,30,23,17,12,5,5,5,0,1,2&chds=0,621&chbh=5&chxt=x&chxl=0:|min=166722|avg=185999|max=207314&chxp=0,1,47,100&chtt=Warrior_Fury_1h_T15H DPS Distribution&chts=dddddd,18,s,333333&chd=t:32.2,27.8,13.4,8.0,7.3,3.3,2.7,2.5,1.1,1.9&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 145.5s|raging_blow 125.6s|wild_strike 60.5s|execute 36.0s|colossus_smash 32.9s|heroic_throw 14.8s|impending_victory 12.0s|dragon_roar 11.3s|battle_shout 5.0s|waiting 8.6s&chtt=Warrior_Fury_1h_T15H Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T15H 185999
battle_shout 0 0.0% 3.3 102.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.26 3.26 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by {$s1=10}%. Lasts {$d=300 seconds}. Generates ${{$92049m1=200}/10} Rage.
berserker_rage 0 0.0% 10.3 45.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.30 10.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&>=20))|(buff.recklessness.remains>=10&!buff.raging_blow.react)
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 8417 4.5% 7.5 64.49sec 507327 0 0 0 0 0.0% 0.0% 0.0% 0.0% 125.1 30321 0 30321 0.0% 0.0% 27.7%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.48 127.66 125.12 125.12 0.0000 1.0000 3793835.08 3793835.08 0.00 30321.57 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.18 94.14% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.48 5.86% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.1 100.00% 30321.37 1444 141754 30331.66 22575 37808 3793835 3793835 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every {$t1=1} sec. Movement slowed by {$s2=50}%.
  • description:Your target bleeds for an additional {$12292s1=30}% damage of the triggering attack over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:61981.35
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 11590 6.2% 94.7 4.79sec 55199 35925 29546 62008 55199 79.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.66 94.66 0.00 0.00 1.5365 0.0000 5225413.69 5225413.69 0.00 35925.10 35925.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.86 20.98% 29546.37 18923 48610 29601.51 25307 35737 586699 586699 0.00
crit 74.81 79.02% 62008.26 37845 123635 62012.60 57732 65787 4638715 4638715 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(<20&debuff.colossus_smash.up&rage>=30)
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Instantly attack the target, dealing {$s2=1}% weapon damage plus {$s1=1246} with your main hand weapon and restoring {$117313s1=1}% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${{$m3=100}/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.90
bloodthirst_heal 0 0.0% 94.7 4.79sec 0 0 0 0 0 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 94.66 94.66 0.00 0.00 0.0000 0.0000 0.00 512407.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.50 66.03% 0.00 0 0 0.00 0 0 0 338322 100.00
crit 32.16 33.97% 0.00 0 0 0.00 0 0 0 174086 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T15H
  • harmful:true
  • if_expr:
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Instantly attack the target, dealing {$s2=1}% weapon damage plus {$s1=1246} with your main hand weapon and restoring {$117313s1=1}% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${{$m3=100}/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 3566 1.9% 21.4 21.51sec 75012 48820 49905 105946 75014 44.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.42 21.42 0.00 0.00 1.5365 0.0000 1606728.18 1606728.18 0.00 48820.40 48820.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.82 55.20% 49905.17 35085 63824 49914.99 43524 55603 590028 590028 0.00
crit 9.60 44.80% 105946.47 70171 153177 106136.76 77397 122129 1016700 1016700 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for {$s3=2}% weapon damage plus {$s1=222} and weakens their defenses, allowing your attacks to bypass {$s2=100}% of their armor for {$s4=6} sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.{$?s89003=false}[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by {$113746s1=4}% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by {$81326s1=4}% for {$81326d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deep_wounds 13110 7.1% 94.7 4.79sec 62423 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.9 26455 56822 39414 42.7% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.66 94.66 149.93 149.93 0.0000 3.0000 5909289.67 5909289.67 0.00 13138.29 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.9 57.32% 26454.65 16842 43504 26460.70 24371 30152 2273537 2273537 0.00
crit 64.0 42.68% 56822.43 33685 99933 56884.48 51364 64023 3635753 3635753 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for {$s1=218} every {$t1=3} sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3955 2.1% 7.4 64.58sec 241852 157413 0 241853 241853 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.37 0.00 0.00 1.5365 0.0000 1781913.31 1781913.31 0.00 157412.84 157412.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 7.37 100.00% 241852.61 143698 392272 242124.68 203127 286567 1781913 1781913 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled&(!debuff.colossus_smash.up&buff.bloodbath.up)
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar ferociously, causing {$?s12712=false}[${{$m1=126}*1.2}][{$m1=126}] damage to all enemies within $A1 yards, knocking them back and knocking them down for {$118895d=500 milliseconds}. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 22522 12.1% 23.4 2.90sec 432906 281747 269884 612144 432910 47.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.41 23.41 0.00 0.00 1.5365 0.0000 10133868.07 10133868.07 0.00 281746.78 281746.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.26 52.37% 269883.53 148104 554228 270072.50 174609 384937 3308631 3308631 0.00
crit 11.15 47.63% 612144.33 296209 1330147 615170.44 441015 945870 6825237 6825237 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing {$?s12712=false}[${{$m1=1}*1.2}][{$m1=1}] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.000000
  • base_dd_min:8100.94
  • base_dd_max:8100.94
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 1991 1.1% 11.0 43.01sec 81832 0 55287 116718 81834 43.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.96 10.96 0.00 0.00 0.0000 0.0000 896491.47 896491.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.22 56.79% 55286.86 34452 89753 55275.34 37310 75820 343949 343949 0.00
crit 4.73 43.21% 116718.46 68904 215407 117013.53 0 169057 552542 552542 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*{$52174m1=1}}][{$52174m1=1}] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 18945 10.2% 97.3 3.95sec 87740 0 59822 126448 87739 41.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.30 97.30 0.00 0.00 0.0000 0.0000 8536888.27 8536888.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.53 58.10% 59821.57 31282 85915 59835.28 54322 65200 3381662 3381662 0.00
crit 40.77 41.90% 126447.95 62564 201272 126489.37 111230 141854 5155226 5155226 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:((debuff.colossus_smash.up&rage>=40)&>=20)|rage>=110
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:An attack that instantly deals {$m2=110}% weapon damage plus {$m1=1} (${{$m2=110}*1.40}% plus ${{$m1=1}*1.40} if a one-handed weapon is equipped){$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 447 0.2% 9.6 41.31sec 20927 13621 14611 30557 20927 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.64 9.64 0.00 0.00 1.5364 0.0000 201711.10 201711.10 0.00 13620.85 13620.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.82 60.39% 14610.64 10253 26222 14607.18 0 19749 85039 85039 0.00
crit 3.82 39.61% 30556.82 20506 60830 30282.41 0 50766 116672 116672 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:
  • description:Throw your weapon at the enemy, causing {$m1=50}% weapon damage{$?s58357=false}[ and silencing the target for {$18498d=3 seconds}][].
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 1755 0.9% 7.8 47.38sec 101679 66178 70208 148860 101677 40.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.79 7.79 0.00 0.00 1.5365 0.0000 791624.16 791624.16 0.00 66178.24 66178.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.67 59.99% 70207.83 47898 140190 70113.39 0 94939 327897 327897 0.00
crit 3.12 40.01% 148859.51 95796 291754 145648.30 0 250331 463727 463727 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&>=20
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:
  • description:Instantly attack the target causing {$?s12712=false}[${1.2*{$m2=56}}][{$m2=56}] damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.560000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory_heal 0 0.0% 7.8 47.38sec 0 0 0 0 0 33.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 7.79 7.79 0.00 0.00 0.0000 0.0000 0.00 421420.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.15 66.09% 0.00 0 0 0.00 0 0 0 278515 99.96
crit 2.64 33.91% 0.00 0 0 0.00 0 0 0 142906 95.33
HPS Timeline Chart

Action details: impending_victory_heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T15H
  • harmful:true
  • if_expr:
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:
  • description:{$@spelldesc103840=Instantly attack the target causing {$?s12712=false}[${1.2*{$m2=56}}][{$m2=56}] damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.}
lightning_strike 8665 4.7% 61.3 7.30sec 63717 0 46187 94988 63715 35.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.31 61.31 0.00 0.00 0.0000 0.0000 3906422.84 3906422.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.29 64.08% 46187.09 38941 73131 46195.17 41926 51136 1814537 1814537 0.00
crit 22.02 35.92% 94987.86 77881 175515 95035.85 84802 111369 2091886 2091886 0.00
DPS Timeline Chart

Action details: lightning_strike

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.750000
  • base_dd_min:280.00
  • base_dd_max:280.00
melee_main_hand 25659 13.8% 248.9 1.81sec 46451 25121 37320 78601 46451 39.6% 13.5% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 248.93 248.93 0.00 0.00 1.8490 0.0000 11562848.27 11562848.27 0.00 25121.50 25121.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.03 22.91% 37319.70 22556 63123 37327.50 32850 41380 2128283 2128283 0.00
crit 98.64 39.63% 78600.76 45112 151496 78645.57 72433 86263 7753313 7753313 0.00
glance 59.77 24.01% 28128.45 16917 47342 28134.32 25173 31635 1681252 1681252 0.00
miss 33.49 13.45% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 21584 11.6% 248.4 1.81sec 39155 21173 31481 66324 39155 39.6% 13.5% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 248.42 248.42 0.00 0.00 1.8493 0.0000 9726777.83 9726777.83 0.00 21172.60 21172.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.96 22.93% 31480.86 19032 53260 31486.89 28021 35097 1793125 1793125 0.00
crit 98.28 39.56% 66323.74 38063 127824 66364.05 61494 72182 6518244 6518244 0.00
glance 59.63 24.00% 23735.21 14274 39945 23737.85 21041 26683 1415409 1415409 0.00
miss 33.55 13.50% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (32854) 0.0% (17.7%) 81.8 5.38sec 181058 117837 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.77 81.77 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 117836.78 117836.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react=2|(buff.raging_blow.react&(debuff.colossus_smash.up|cooldown.colossus_smash.remains>=3|(cooldown.bloodthirst.remains>=1&buff.raging_blow.remains<=3)))
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$96103m2=190}% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit {$131116s1=2} charges.
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 17814 9.6% 81.8 5.38sec 98175 0 66353 140954 98172 42.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.77 81.77 0.00 0.00 0.0000 0.0000 8028052.42 8028052.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.89 57.35% 66352.63 37690 98026 66376.01 60751 73505 3111507 3111507 0.00
crit 34.88 42.65% 140954.46 75381 236841 141071.46 123173 160391 4916546 4916546 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$m2=190}% weapon damage from both melee weapons. Can only be used while Enraged.
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.90
raging_blow_oh 15040 8.1% 81.8 5.38sec 82884 0 55968 118969 82882 42.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.77 81.77 0.00 0.00 0.0000 0.0000 6777668.20 6777668.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.84 57.28% 55967.78 31801 83264 55988.15 50914 61473 2621437 2621437 0.00
crit 34.94 42.72% 118968.66 63603 198502 119062.15 104644 134716 4156231 4156231 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$m2=190}% weapon damage from both melee weapons. Can only be used while Enraged.
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.90
recklessness 0 0.0% 2.0 nansec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))&(!talent.bloodbath.enabled|cooldown.bloodbath.remains<=3|((target.time_to_die>315&target.time_to_die<(315+cooldown.bloodbath.remains))|(set_bonus.tier14_4pc_melee&target.time_to_die>165&target.time_to_die<(165+cooldown.bloodbath.remains))))|target.time_to_die<=18
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional {$s1=50}% chance to critically hit. Lasts {$d=12 seconds}.
stormlash 1522 0.8% 61.3 5.31sec 11037 0 8063 17763 11037 30.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.25 61.25 0.00 0.00 0.0000 0.0000 676050.40 676050.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.47 69.34% 8062.83 2061 19423 8085.95 5810 11307 342437 342437 0.00
crit 18.78 30.66% 17762.78 4122 44493 17819.24 9009 30544 333614 333614 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:9815.08
  • base_dd_max:9815.08
wild_strike 9418 5.1% 52.3 6.87sec 81181 70231 56668 118688 81179 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.33 52.33 0.00 0.00 1.1559 0.0000 4248222.01 4248222.01 0.00 70231.31 70231.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.65 60.48% 56668.48 39453 102068 56692.12 48565 63809 1793413 1793413 0.00
crit 20.68 39.52% 118688.40 78905 244963 118631.93 98056 139369 2454809 2454809 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&>=20&cooldown.bloodthirst.remains<=1
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals {$m3=230}% weapon damage plus {$s2=436 + 100.0%} and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:436.20
  • base_dd_max:436.20
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 10.3 0.0 46.0sec 45.9sec 13.60% 13.60%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:13.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
bloodbath 7.5 0.0 64.5sec 64.5sec 19.62% 21.11%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodbath_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional {$12292s1=30}% bleed damage.
  • description:For the next {$12292d=12 seconds}, causes your melee special attacks to deal an additional {$12292s1=30}% damage as a bleed over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.03%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 13.9 5.0 31.2sec 22.8sec 36.46% 75.47%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:0.00

Stack Uptimes

  • bloodsurge_1:8.70%
  • bloodsurge_2:5.60%
  • bloodsurge_3:22.15%

Trigger Attempt Success

  • trigger_pct:20.07%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike is free and has a 1 sec global cooldown.
  • description:{$@spelldesc46915=Your Bloodthirst hits have a {$46915s1=20}% chance of making your next 3 Wild Strikes free and reducing their global cooldown to 1 sec.}
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
dancing_steel 12.3 8.9 35.9sec 20.3sec 43.43% 42.72%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:43.43%

    Trigger Attempt Success

    • trigger_pct:99.60%
dancing_steel_oh 12.3 8.9 35.9sec 20.3sec 43.57% 43.01%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:43.57%

    Trigger Attempt Success

    • trigger_pct:99.76%
enrage 18.7 82.4 24.7sec 4.5sec 92.50% 92.24%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:92.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by {$s2=10}%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:{$@spelldesc13046=Mortal Strike, Bloodthirst and Colossus Smash critical strikes and critical blocks Enrage you, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}.}
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 59.3 30.5 7.5sec 5.0sec 35.92% 36.69%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:0.00

Stack Uptimes

  • flurry_1:12.51%
  • flurry_2:11.53%
  • flurry_3:11.88%

Trigger Attempt Success

  • trigger_pct:8.97%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by {$s1=25}%.
  • description:Your melee hits have a {$12972h=9}% chance to increase your attack speed by {$12968s1=25}% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
gaze_of_the_twins 5.7 2.6 70.8sec 46.6sec 30.31% 30.31%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_gaze_of_the_twins
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3238.00

    Stack Uptimes

    • gaze_of_the_twins_1:21.00%
    • gaze_of_the_twins_2:6.40%
    • gaze_of_the_twins_3:2.92%

    Trigger Attempt Success

    • trigger_pct:99.80%
mogu_power_potion 1.0 0.0 409.6sec 0.0sec 9.58% 9.58%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:4000.03

    Stack Uptimes

    • mogu_power_potion_1:9.58%

    Trigger Attempt Success

    • trigger_pct:100.00%

Spelldata details

  • id:105706
  • name:Potion of Mogu Power
  • tooltip:Strength increased by {$s1=4000}.
  • description:Increases your Strength by {$s1=4000} for {$d=25 seconds}.
  • max_stacks:
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
primordius_talisman_of_rage 15.9 15.4 28.1sec 14.0sec 50.64% 50.64%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_primordius_talisman_of_rage
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1736.00

    Stack Uptimes

    • primordius_talisman_of_rage_1:25.67%
    • primordius_talisman_of_rage_2:12.64%
    • primordius_talisman_of_rage_3:6.22%
    • primordius_talisman_of_rage_4:3.09%
    • primordius_talisman_of_rage_5:3.02%

    Trigger Attempt Success

    • trigger_pct:99.42%
raging_blow 52.1 49.1 7.8sec 4.5sec 63.77% 63.77%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raging_blow_1:39.13%
  • raging_blow_2:24.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
recklessness 2.0 0.0 409.4sec 0.0sec 5.36% 4.86%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • recklessness_1:5.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional {$s1=50}% chance to critically hit. Lasts {$d=12 seconds}.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
skull_banner 5.9 0.0 75.3sec 75.3sec 12.95% 16.25%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_skull_banner
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • skull_banner_1:12.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114207
  • name:Skull Banner
  • tooltip:
  • description:Throw down a war banner at your feet that increases the critical damage of party or raid members within $114206A1 yards of the banner by {$114206s1=20}%. Lasts {$114207d=10 seconds}. You can Intervene to your war banner.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:10.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
synapse_springs_2 7.5 0.0 64.5sec 64.5sec 16.39% 16.39%

Buff details

  • buff initial source:Warrior_Fury_1h_T15H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.39%

    Trigger Attempt Success

    • trigger_pct:100.00%
Constant Buffs


Resource Usage Type Count Total Average RPE APR
execute Rage 23.4 702.4 30.0 30.0 14426.6
heroic_strike Rage 97.3 2918.8 30.0 30.0 2924.8
impending_victory Rage 7.8 77.8 10.0 10.0 10168.6
raging_blow Rage 81.8 817.7 10.0 10.0 18106.3
wild_strike Rage 52.3 374.9 7.2 7.2 11332.9
Resource Gains Type Count Total Average Overflow
battle_shout Rage 3.26 65.13 (1.32%) 20.00 0.00 0.00%
bloodthirst Rage 94.66 946.62 (19.23%) 10.00 0.03 0.00%
enrage Rage 101.12 987.04 (20.05%) 9.76 24.20 2.39%
melee_main_hand Rage 215.44 1958.57 (39.79%) 9.09 1.97 0.10%
melee_off_hand Rage 214.87 965.24 (19.61%) 4.49 1.69 0.17%
Resource RPS-Gain RPS-Loss
Rage 10.91 10.84
Combat End Resource Mean Min Max
Health 541287.00 541287.00 541287.00
Rage 31.19 0.10 86.50
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%


Count Interval
lightning_strike 61.3 7.3sec
t15_2pc_melee 6.4 58.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9992
Mean 451.18
Minimum 342.27
Maximum 561.18
Spread ( max - min ) 218.91
Range [ ( max - min ) / 2 * 100% ] 24.26%
Distribution Chart


Sample Data Warrior_Fury_1h_T15H Damage Per Second
Count 9992
Mean 185999.19
Minimum 166721.60
Maximum 207314.25
Spread ( max - min ) 40592.65
Range [ ( max - min ) / 2 * 100% ] 10.91%
Standard Deviation 5347.1063
5th Percentile 177405.14
95th Percentile 195114.85
( 95th Percentile - 5th Percentile ) 17709.71
Mean Distribution
Standard Deviation 53.4925
95.00% Confidence Intervall ( 185894.35 - 186104.04 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3174
0.1 Scale Factor Error with Delta=300 244073
0.05 Scale Factor Error with Delta=300 976295
0.01 Scale Factor Error with Delta=300 24407387
Distribution Chart


Sample Data
Count 9992
Mean 185999.19
Distribution Chart


Sample Data
Count 9992
Mean 83803804.98
Distribution Chart


Sample Data Warrior_Fury_1h_T15H Damage Taken Per Second
Count 9992
Mean 0.00
Distribution Chart


Sample Data Warrior_Fury_1h_T15H Healing Per Second
Count 9992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 9992
Mean 0.00
Distribution Chart


Sample Data
Count 9992
Mean 0.00
Distribution Chart


Sample Data Warrior_Fury_1h_T15H Healing taken Per Second
Count 9992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 9992
Mean 463.14
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mogu_power_potion,if=(<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 2.00 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))&(!talent.bloodbath.enabled|cooldown.bloodbath.remains<=3|((target.time_to_die>315&target.time_to_die<(315+cooldown.bloodbath.remains))|(set_bonus.tier14_4pc_melee&target.time_to_die>165&target.time_to_die<(165+cooldown.bloodbath.remains))))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(>=20&target.time_to_die>195)|(<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.48 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(debuff.colossus_smash.remains>=5&(target.time_to_die>79|(target.time_to_die<79&<20&(buff.recklessness.up|cooldown.recklessness.remains>=(target.time_to_die-25)))))
A 7.48 use_item,name=reinbinders_fists,use_off_gcd=1,if=!talent.bloodbath.enabled|(talent.bloodbath.enabled&buff.bloodbath.up)
B 10.30 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&>=20))|(buff.recklessness.remains>=10&!buff.raging_blow.react)
C 10.96 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
D 97.29 heroic_strike,use_off_gcd=1,if=((debuff.colossus_smash.up&rage>=40)&>=20)|rage>=110
E 94.66 bloodthirst,if=!(<20&debuff.colossus_smash.up&rage>=30)
F 15.71 wild_strike,if=buff.bloodsurge.react&>=20&cooldown.bloodthirst.remains<=1
G 23.98 wait,sec=cooldown.bloodthirst.remains,if=!(<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1&cooldown.bloodthirst.remains
H 7.37 dragon_roar,if=talent.dragon_roar.enabled&(!debuff.colossus_smash.up&buff.bloodbath.up)
I 21.42 colossus_smash
J 23.42 execute
K 0.00 storm_bolt,if=talent.storm_bolt.enabled
L 81.77 raging_blow,if=buff.raging_blow.react=2|(buff.raging_blow.react&(debuff.colossus_smash.up|cooldown.colossus_smash.remains>=3|(cooldown.bloodthirst.remains>=1&buff.raging_blow.remains<=3)))
M 24.11 wild_strike,if=buff.bloodsurge.react&>=20
N 0.00 shockwave,if=talent.shockwave.enabled
O 9.64 heroic_throw
P 3.14 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&>=20
R 0.86 wild_strike,if=debuff.colossus_smash.up&>=20
S 7.79 impending_victory,if=talent.impending_victory.enabled&>=20
T 11.64 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=80&>=20
U 0.11 battle_shout,if=rage<70

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 22197 19775 18625
Agility 226 215 80
Stamina 28206 25642 25454
Intellect 121 115 80
Spirit 146 146 80
Health 541287 505391 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 20.58% 20.58% 4429
Spell Crit 31.63% 26.63% 15373
Spell Haste 15.76% 10.24% 4354
ManaReg per Second 0 0 0
Attack Power 49075 39770 0
Melee Hit 13.03% 13.03% 4429
Melee Crit 36.64% 31.64% 15373
Melee Haste 15.37% 15.37% 4354
Swing Speed 26.90% 15.37% 4354
Expertise 7.55% / 7.55% 7.55% / 7.55% 2568
Armor 37021 37021 37021
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.01% 5.01% 0
Tank-Parry 25.20% 22.98% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 25.66% 18.66% 3200


Source Slot Average Item Level: 535.00
Local Head helmet_of_the_last_mogu,id=96730,gems=capacitive_primal_320crit_180crit,reforge=hit_crit
Local Neck amulet_of_the_primal_turtle,id=96429,gems=160hit_160crit_60crit,reforge=hit_mastery
Local Shoulders pauldrons_of_the_last_mogu,id=96734,gems=160exp_160crit_320crit_120crit,enchant=200str_100crit,reforge=exp_crit
Shirt empty
Local Chest battleplate_of_the_last_mogu,id=96731,gems=160exp_160crit_320crit_160crit_160hit_180strength,enchant=80all,reforge=exp_crit
Local Waist abandoned_zandalari_goreplate,id=96719,gems=160crit_160hit_320crit_60str,reforge=hit_mastery
Local Legs legplates_of_the_last_mogu,id=96733,gems=320crit_160hit_160crit_120str,enchant=285str_165crit
Local Feet tidal_force_treads,id=96542,gems=160crit_160exp_60crit,enchant=140mastery
Local Wrists frozen_warlords_bracers,id=96394,gems=320crit,enchant=180str,reforge=exp_crit
Local Hands reinbinders_fists,id=96533,gems=320crit_160exp_160crit_160hit_160crit_120str,enchant=170str,addon=synapse_springs_mark_ii,reforge=haste_mastery
Local Finger1 spinescale_seal,id=96448,reforge=hit_mastery
Local Finger2 band_of_the_scaled_tyrant,id=96500,gems=160exp_160crit_60haste,reforge=hit_crit
Local Trinket1 primordius_talisman_of_rage,id=96501
Local Trinket2 gaze_of_the_twins,id=96543
Local Back hydrascale_bloodcloak,id=96499,gems=160hit_160crit_60str,enchant=180crit,reforge=exp_mastery
Local Main Hand shellsplitter_greataxe,id=96430,gems=160crit_160hit_60str,enchant=dancing_steel
Local Off Hand shellsplitter_greataxe,id=96430,gems=160crit_160hit_60str,enchant=dancing_steel
Unknown empty
Tabard empty


15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt







# Gear Summary
# gear_strength=18625
# gear_agility=80
# gear_stamina=25454
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2568
# gear_hit_rating=4429
# gear_crit_rating=15373
# gear_haste_rating=4354
# gear_mastery_rating=3200
# gear_armor=37021
# meta_gem=capacitive_primal
# tier15_2pc_melee=1
# tier15_4pc_melee=1
# hands=reinbinders_fists,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shellsplitter_greataxe,heroic=1,weapon=axe_2.60speed_8674min_16109max,enchant=dancing_steel
# off_hand=shellsplitter_greataxe,heroic=1,weapon=axe_2.60speed_8674min_16109max,enchant=dancing_steel

Warrior_Fury_2h_T14H : 181678 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
181678.2 181678.2 97.33 / 0.05% 8173 / 4.5% 16925.9 10.7 10.8 Rage 1.79% 61.3 100.0% 100%
  • Glyph of Unending Rage
  • Glyph of Death From Above
  • engineering: 600
  • blacksmithing: 600
Scale Factors for Warrior_Fury_2h_T14H Damage Per Second
Str Agi AP Exp Hit InvHit Crit Haste Mastery Wdps WOHdps
Scale Factors 3.67 0.16 1.75 7.08 4.56 1.91 3.18 2.29 2.96 8.84 3.79
Normalized 1.00 0.04 0.48 1.93 1.24 0.52 0.87 0.62 0.81 2.41 1.03
Scale Deltas 1000 1000 1000 -1000 -1000 1000 1000 1000 1000 300 300
Error 0.14 0.14 0.14 0.21 0.14 0.14 0.14 0.14 0.14 0.46 0.46
Gear Ranking
  • Wdps > Exp > Hit > WOHdps ~= Str > Crit > Mastery > Haste > InvHit > AP > Agi
Pawn string
  • ( Pawn: v1: "Warrior_Fury_2h_T14H": Strength=3.67, Agility=0.16, Ap=1.75, ExpertiseRating=7.08, HitRating=4.56, CritRating=3.18, HasteRating=2.29, MasteryRating=2.96, MeleeDps=8.84 )
Zero hit/exp
  • ( Pawn: v1: "Warrior_Fury_2h_T14H": Strength=3.67, Agility=0.16, Ap=1.75, ExpertiseRating=0.00, HitRating=0.00, CritRating=3.18, HasteRating=2.29, MasteryRating=2.96, MeleeDps=8.84 )

Charts,s,333333&chd=t:237558|137398|130532|70024|69868|65030|47186|23489|18271|14666&chds=0,475116&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++237558++execute,C79C6E,0,0,15|t++137398++raging_blow,C79C6E,1,0,15|t++130532++dragon_roar,C79C6E,2,0,15|t++70024++wild_strike,C79C6E,3,0,15|t++69868++impending_victory,C79C6E,4,0,15|t++65030++colossus_smash,C79C6E,5,0,15|t++47186++bloodthirst,C79C6E,6,0,15|t++23489++melee_main_hand,C79C6E,7,0,15|t++18271++heroic_throw,C79C6E,8,0,15|t++14666++melee_off_hand,C79C6E,9,0,15&chtt=Warrior_Fury_2h_T14H Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:13,13,10,10,8,8,8,6,5,5,5,3,2,1,1,1,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=raging_blow_mh|melee_main_hand|execute|heroic_strike|raging_blow_oh|bloodthirst|melee_off_hand|deep_wounds|wild_strike|lightning_strike|bloodbath|colossus_smash|dragon_roar|impending_victory|heroic_leap|stormlash|heroic_throw&chtt=Warrior_Fury_2h_T14H Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:8.84,7.08,4.56,3.79,3.67,3.18,2.96,2.29,1.91,1.75,0.16|8.38,6.86,4.42,3.34,3.53,3.04,2.83,2.15,1.77,1.61,0.02|9.30,7.29,4.70,4.25,3.81,3.31,3.10,2.43,2.04,1.89,0.29&chco=C79C6E&chm=E,FF0000,1:0,,1:20|t++++8.84++Wdps,C79C6E,0,0,15,0.1,e|t++++7.08++Exp,C79C6E,0,1,15,0.1,e|t++++4.56++Hit,C79C6E,0,2,15,0.1,e|t++++3.79++WOHdps,C79C6E,0,3,15,0.1,e|t++++3.67++Str,C79C6E,0,4,15,0.1,e|t++++3.18++Crit,C79C6E,0,5,15,0.1,e|t++++2.96++Mastery,C79C6E,0,6,15,0.1,e|t++++2.29++Haste,C79C6E,0,7,15,0.1,e|t++++1.91++InvHit,C79C6E,0,8,15,0.1,e|t++++1.75++AP,C79C6E,0,9,15,0.1,e|t++++0.16++Agi,C79C6E,0,10,15,0.1,e&chds=-0.010,10.614&chtt=Scale Factors|Warrior_Fury_2h_T14H%20Damage%20Per%20Second&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:4244243232132434862320zxvvtssqppnnmlkhhihhhhggfgffffffeedddddeffggghhhiiiiijjjjiiiihhgggfffeeeeeddddddccdddddddddddddddddddeefffghhhiiijjjjjjjiiihhhhggfffeeedddddddddddddddddddeeffgghhijjklmnpqrstuvvvvuuutsrrqponmlkjihggfffeeedddddddddddddddddddddddddeeeffgghhhiiijjjjjjjiiihhhgggfffeeeeddddddddddeeeeeffffffggggghhiiijjjkklllmmmmmmmmmmllkkkjjjiiihhhgggggfgghijjklmnnnopqrrstuwwwwwwwwwwwxxxxxwwvvutsrrqpponnmllkkjjjiiiiihhhhhiiiiiiiiijjjjkkllmnnopqrstuvwxxyyzzzzyyxxwvuutsrqqpoonmmlllkkkjjjjjjjjjjjjjjjkkkllmmnnopqqrssttuuvvvvvuuutssrrqqqqppppppqppqpnnnnnnonnml&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6055,0.4&chxt=x,y&chxl=0:|0|sec=561|1:|0|avg=181678|max=300054&chxp=1,1,61,100&chtt=Warrior_Fury_2h_T14H DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,1,3,4,9,14,16,23,45,56,87,115,148,220,255,319,356,388,473,569,562,578,601,615,617,544,502,460,431,369,327,268,242,195,121,126,100,70,48,32,27,23,10,5,11,4,0,2&chds=0,617&chbh=5&chxt=x&chxl=0:|min=162616|avg=181678|max=200129&chxp=0,1,51,100&chtt=Warrior_Fury_2h_T14H DPS Distribution&chts=dddddd,18,s,333333&chd=t:32.2,28.8,12.8,7.9,7.3,3.3,2.6,2.5,1.1,1.8&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 145.5s|raging_blow 129.9s|wild_strike 57.7s|execute 35.5s|colossus_smash 32.9s|heroic_throw 14.7s|impending_victory 11.7s|dragon_roar 11.3s|battle_shout 4.8s|waiting 8.1s&chtt=Warrior_Fury_2h_T14H Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T14H 181678
battle_shout 0 0.0% 3.1 105.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.13 3.13 0.00 0.00 1.5366 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by {$s1=10}%. Lasts {$d=300 seconds}. Generates ${{$92049m1=200}/10} Rage.
berserker_rage 0 0.0% 9.2 52.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.20 9.20 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&>=20))|(buff.recklessness.remains>=10&!buff.raging_blow.react)
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${{$12880m1=100}/10} Rage and increasing physical damage done by {$12880s2=10}% for {$12880d=6 seconds}. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 8528 4.7% 7.5 64.49sec 514302 0 0 0 0 0.0% 0.0% 0.0% 0.0% 125.1 30726 0 30726 0.0% 0.0% 27.7%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.47 128.55 125.06 125.06 0.0000 1.0000 3842699.57 3842699.57 0.00 30726.36 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.08 94.19% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.47 5.81% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.1 100.00% 30726.01 1524 109146 30751.84 25077 38185 3842700 3842700 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every {$t1=1} sec. Movement slowed by {$s2=50}%.
  • description:Your target bleeds for an additional {$12292s1=30}% damage of the triggering attack over {$113344d=6 seconds}. While bleeding, the target moves at {$113344s2=50}% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:48480.11
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 15222 8.4% 94.7 4.79sec 72501 47186 37888 79169 72501 83.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.67 94.67 0.00 0.00 1.5365 0.0000 6863931.04 6863931.04 0.00 47186.13 47186.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.29 16.15% 37888.06 23581 61968 37965.55 31020 47515 579387 579387 0.00
crit 79.38 83.85% 79169.09 47162 151747 79175.82 74946 83009 6284544 6284544 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(<20&debuff.colossus_smash.up&rage>=30)
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Instantly attack the target, dealing {$s2=1}% weapon damage plus {$s1=1246} with your main hand weapon and restoring {$117313s1=1}% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${{$m3=100}/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.90
bloodthirst_heal 0 0.0% 94.7 4.79sec 0 0 0 0 0 36.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 94.67 94.67 0.00 0.00 0.0000 0.0000 0.00 556430.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.78 63.14% 0.00 0 0 0.00 0 0 0 351335 100.00
crit 34.90 36.86% 0.00 0 0 0.00 0 0 0 205096 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Instantly attack the target, dealing {$s2=1}% weapon damage plus {$s1=1246} with your main hand weapon and restoring {$117313s1=1}% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${{$m3=100}/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 4747 2.6% 21.4 21.51sec 99918 65030 65264 137820 99920 47.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.40 21.40 0.00 0.00 1.5365 0.0000 2138585.98 2138585.98 0.00 65030.29 65030.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.18 52.24% 65264.38 44586 79752 65270.63 56176 70850 729685 729685 0.00
crit 10.22 47.76% 137820.43 89172 191405 138064.07 116439 167968 1408901 1408901 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for {$s3=2}% weapon damage plus {$s1=222} and weakens their defenses, allowing your attacks to bypass {$s2=100}% of their armor for {$s4=6} sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.{$?s89003=false}[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by {$113746s1=4}% for {$113746d=30 seconds}. Stacks up to {$113746u=3} times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by {$81326s1=4}% for {$81326d=30 seconds}.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deep_wounds 11157 6.1% 94.7 4.79sec 53121 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.9 22115 47217 33549 45.5% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.67 94.67 149.90 149.90 0.0000 3.0000 5029095.61 5029095.61 0.00 11182.93 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.6 54.45% 22114.71 13693 35009 22119.52 20408 24520 1805123 1805123 0.00
crit 68.3 45.55% 47217.08 27386 84022 47262.81 42874 52595 3223973 3223973 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for {$s1=218} every {$t1=3} sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over {$115767d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3277 1.8% 7.4 64.58sec 200551 130532 0 200550 200550 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.36 7.36 0.00 0.00 1.5365 0.0000 1476838.49 1476838.49 0.00 130531.95 130531.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 7.36 100.00% 200549.60 116080 316547 200758.34 168492 235568 1476838 1476838 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled&(!debuff.colossus_smash.up&buff.bloodbath.up)
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:
  • description:Roar ferociously, causing {$?s12712=false}[${{$m1=126}*1.2}][{$m1=126}] damage to all enemies within $A1 yards, knocking them back and knocking them down for {$118895d=500 milliseconds}. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 18758 10.3% 23.1 2.94sec 365005 237558 223592 504229 365007 50.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.13 23.13 0.00 0.00 1.5365 0.0000 8442097.96 8442097.96 0.00 237557.98 237557.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.47 49.61% 223591.54 120039 445594 223649.23 157784 389353 2565383 2565383 0.00
crit 11.65 50.39% 504228.98 240077 1069427 506777.54 369760 731965 5876715 5876715 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing {$?s12712=false}[${{$m1=1}*1.2}][{$m1=1}] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.000000
  • base_dd_min:8100.94
  • base_dd_max:8100.94
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 1687 0.9% 10.9 43.01sec 69447 0 46121 96655 69451 46.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 10.95 0.00 0.00 0.0000 0.0000 760188.01 760188.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.89 53.84% 46120.81 28056 72263 46117.73 0 62095 271812 271812 0.00
crit 5.05 46.16% 96655.49 56111 173431 96760.28 0 151303 488376 488376 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal {$?s12712=false}[${1.2*{$52174m1=1}}][{$52174m1=1}] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 17701 9.7% 96.3 3.99sec 82827 0 55393 116685 82826 44.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.30 96.30 0.00 0.00 0.0000 0.0000 7976426.69 7976426.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.20 55.24% 55393.17 28241 72899 55406.37 49707 60361 2946906 2946906 0.00
crit 43.10 44.76% 116685.41 56481 182541 116720.57 104868 129156 5029520 5029520 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:((debuff.colossus_smash.up&rage>=40)&>=20)|rage>=110
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:
  • description:An attack that instantly deals {$m2=110}% weapon damage plus {$m1=1} (${{$m2=110}*1.40}% plus ${{$m1=1}*1.40} if a one-handed weapon is equipped){$?s58366=false}[, reducing the target's movement speed by {$129923s1=50}% for {$129923d=8 seconds}][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 595 0.3% 9.6 41.64sec 28072 18271 19118 39990 28074 42.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.57 9.57 0.00 0.00 1.5365 0.0000 268650.06 268650.06 0.00 18270.54 18270.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.46 57.10% 19118.47 13069 33899 19101.80 0 28228 104468 104468 0.00
crit 4.11 42.90% 39990.33 26137 73629 39804.22 0 57028 164182 164182 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:
  • description:Throw your weapon at the enemy, causing {$m1=50}% weapon damage{$?s58357=false}[ and silencing the target for {$18498d=3 seconds}][].
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 1818 1.0% 7.6 47.99sec 107345 69868 72638 153385 107346 43.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.64 7.64 0.00 0.00 1.5365 0.0000 819825.84 819825.84 0.00 69867.55 69867.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.35 57.02% 72637.95 48357 131759 72418.59 0 126655 316319 316319 0.00
crit 3.28 42.98% 153385.40 96713 275330 151185.41 0 234355 503507 503507 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&>=20
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:
  • description:Instantly attack the target causing {$?s12712=false}[${1.2*{$m2=56}}][{$m2=56}] damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.560000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory_heal 0 0.0% 7.6 47.99sec 0 0 0 0 0 36.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 7.64 7.64 0.00 0.00 0.0000 0.0000 0.00 448874.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.83 63.31% 0.00 0 0 0.00 0 0 0 284164 99.93
crit 2.80 36.69% 0.00 0 0 0.00 0 0 0 164710 96.21
HPS Timeline Chart

Action details: impending_victory_heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:
  • description:{$@spelldesc103840=Instantly attack the target causing {$?s12712=false}[${1.2*{$m2=56}}][{$m2=56}] damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.}
lightning_strike 8819 4.9% 56.3 7.95sec 70632 0 50070 103055 70632 38.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.29 56.29 0.00 0.00 0.0000 0.0000 3976047.49 3976047.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.45 61.19% 50070.28 42780 76969 50084.48 46319 55346 1724824 1724824 0.00
crit 21.85 38.81% 103055.07 85561 184725 103106.82 93109 119515 2251224 2251224 0.00
DPS Timeline Chart

Action details: lightning_strike

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.750000
  • base_dd_min:280.00
  • base_dd_max:280.00
melee_main_hand 24096 13.3% 182.2 2.47sec 59606 23489 48720 101999 59607 41.7% 17.3% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.17 182.17 0.00 0.00 2.5376 0.0000 10858483.22 10858483.22 0.00 23489.08 23489.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.90 16.96% 48719.86 28751 78651 48730.35 41992 57004 1505472 1505472 0.00
crit 75.97 41.70% 101998.51 57502 188761 102053.89 93130 111531 7748897 7748897 0.00
glance 43.70 23.99% 36708.22 21563 58988 36716.44 32249 41543 1604114 1604114 0.00
miss 31.60 17.35% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 15006 8.3% 181.7 2.48sec 37223 14666 30487 63735 37221 41.6% 17.4% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.67 181.67 0.00 0.00 2.5380 0.0000 6762327.23 6762327.23 0.00 14666.25 14666.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.84 16.98% 30487.42 17970 49157 30500.26 26029 35397 940315 940315 0.00
crit 75.64 41.64% 63734.61 35939 117976 63769.72 58202 71064 4821066 4821066 0.00
glance 43.63 24.02% 22941.00 13477 36867 22945.14 20139 25926 1000946 1000946 0.00
miss 31.55 17.37% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (39616) 0.0% (21.8%) 84.6 5.20sec 211111 137398 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.57 84.57 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 137398.15 137398.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react=2|(buff.raging_blow.react&(debuff.colossus_smash.up|cooldown.colossus_smash.remains>=3|(cooldown.bloodthirst.remains>=1&buff.raging_blow.remains<=3)))
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow that deals {$96103m2=190}% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit {$131116s1=2} charges.
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 24379 13.4% 84.6 5.20sec 129912 0 86216 182477 129908 45.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.57 84.57 0.00 0.00 0.0000 0.0000 10986462.78 10986462.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.18 54.61% 86215.92 48110 124370 86249.15 77403 94082 3981542 3981542 0.00
crit 38.39 45.39% 182476.52 96219 296441 182598.86 163860 204991 7004921 7004921 0.00