
SimulationCraft 505-2

for World of Warcraft 5.0.5 Live (build level 16048)

Beta Release

Table of Contents

Raid Summary


DPS Chart
HPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Priest_Disc_T14H - - - - - - - - - -0.38 - - - -0.40 - - - - - - wowhead lootrank
Priest_Holy_T14H - - - - - - - - - -0.48 - - - -0.45 - - - - - - wowhead lootrank
Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Warrior_Protection_T14H - - - - - - - -0.79 - -0.87 - - - -0.83 - - - -0.42 -0.35 - wowhead lootrank
Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
Healing Target - - - - - - - - - - - - - - - - - - - - wowhead lootrank

Priest_Disc_T14H : 20230 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
3987.6 3987.6 6.12 / 0.15% 811 / 20.3% 0.3 20230.3 20230.3 15.08 / 0.07% 2000 / 9.9% 3.6 5563.5 4963.7 Mana 23.84% 28.8 100.0%
  • power_word_shield
  • prayer_of_mending
  • renew
Scale Factors for Priest_Disc_T14H's healing per second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 0.00 0.00 0.00 -0.38 0.00 0.00 -0.40
Normalized 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.00 0.00 0.00 0.02 0.00 0.00 0.02
Gear Ranking

Charts,s,333333&chd=t:105822|22897|18913|15307&chds=0,211645&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++105822++power_word_shield,F58CBA,0,0,15|t++22897++renew,F58CBA,1,0,15|t++18913++penance_heal,F58CBA,2,0,15|t++15307++greater_heal,F58CBA,3,0,15&chtt=Priest_Disc_T14H Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:40,26,24,8,3&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=power_word_shield|penance_heal|greater_heal|renew|power_word_shield_glyph&chtt=Priest_Disc_T14H Healing Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:kiomjnllmkmmnlknnnpnsrsrsvssvttuw2xy1z2zywy0z0323212zxttxssstusppmliiljnnmponkjliijjkiijijfecdhhhjjkmoqqqvv0zy0z1zzxwwwvwurropjigghedddecbbZbYYaYYZZbZYZZbbceeghiklnnorqqssvvuvuurqrpqmljihedeaaYXYWWWWXVWVWXXYaaccdfefiknoqsuwyy2355555665853301yvvttpnlkkihhghfefccbabZYYXYXWXXZYZccfggjkknnrsswwyxxxxxuuususqronlklhggfgeddcdaaZYZYXZXWXWXXXabfefhjlnoqruvw0zy112zyxwyvttqpnljhheeebbaZaYYXXZXXYYZZZaaaccggiklooqstwwxzz1102100z0xvvturppnnkjihigghddcbcZZYXYWWWWXWWXXabcgghklopqtuxxxyyzyxywywuwsrrpqmlkjljiihiffdcdbabYYXWYWWXWZZZcdghilnprrtuwwy11324&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=539|1:|0|avg=3988|max=31880&chxp=1,1,13,100&chtt=Priest_Disc_T14H DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,0,12,8,36,52,44,80,136,140,256,332,408,548,624,800,1008,1104,1232,1328,1480,1588,1676,1504,1488,1516,1268,1176,944,884,804,568,484,432,272,256,128,112,76,60,64,16,4,16,12,12,0,4,0,4&chds=0,1676&chbh=5&chxt=x&chxl=0:|min=15889|avg=20230|max=25383&chxp=0,1,46,100&chtt=Priest_Disc_T14H HPS Distribution&chts=dddddd,18,s,333333&chd=t:31.3,27.4,8.1,7.3,2.1,23.8&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,9482C9,ffffff&chl=greater_heal 140.9s|penance_heal 123.1s|power_word_shield 36.5s|renew 32.7s|mindbender 9.2s|waiting 107.3s&chtt=Priest_Disc_T14H Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Disc_T14H 3988
berserking 0 0.0% 3.0 181.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
divine_aegis 1691 42.4% 0.0 nansec 0 0 9097 0 9097 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 83.66 0.00 0.00 0.0000 0.0000 761088.28 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.66 100.00% 9096.88 -122686 147896 9188.02 3852 16847 761088 0 0.00
DPS Timeline Chart
greater_heal 4796 23.7% 69.4 6.37sec 31073 15307 29854 33259 31073 35.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 69.43 69.43 0.00 0.00 2.0299 0.0000 2157252.54 12375670.92 82.57 15307.37 15307.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.56 64.19% 29853.84 0 135888 29777.11 8524 53927 1330407 5852930 77.27
crit 24.86 35.81% 33258.59 0 271776 33170.25 1984 91878 826846 6522741 87.32
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:buff.inner_focus.up
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
greater_heal_divine_aegis 0 0.0% 10.4 39.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 10.43 10.43 0.00 0.00 0.0000 0.0000 0.00 365484.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.43 100.00% 0.00 0 0 0.00 0 0 0 365485 100.00
HPS Timeline Chart

Action details: greater_heal_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:20383.46
  • base_dd_max:20383.46
inner_focus 0 0.0% 14.9 31.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inner_focus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inner_focus

Static Values
  • id:89485
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:
  • id:89485
  • name:Inner Focus
  • school:physical
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
mindbender 0 0.0% 7.3 60.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.25 0.00 0.00 1.2752 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:mana.pct<=20
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
penance_heal 5169 25.6% 65.2 6.94sec 35727 18913 0 0 0 0.0% 0.0% 0.0% 0.0% 195.1 10626 17841 11950 18.3% 0.0% 23.8%

Stats details: penance_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 65.16 65.16 195.11 194.81 1.8890 0.5478 2327948.27 8730243.05 73.33 18913.03 18913.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.1 81.65% 10625.94 0 39423 10614.46 5765 16288 1690197 6022168 71.93
crit 35.7 18.35% 17841.22 0 78845 17844.15 2116 35881 637751 2708075 76.45
HPS Timeline Chart

Action details: penance_heal

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9300.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:buff.grace.down
  • id:47540
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: penance_heal_tick

Static Values
  • id:47666
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:47666
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc47540
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:6202.59
  • base_dd_max:7008.46
penance_heal_tick_divine_aegis 0 0.0% 12.6 32.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: penance_heal_tick_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 12.64 12.64 0.00 0.00 0.0000 0.0000 0.00 281656.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.64 100.00% 0.00 0 0 0.00 0 0 0 281656 100.00
HPS Timeline Chart

Action details: penance_heal_tick_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:11180.42
  • base_dd_max:11180.42
power_word_shield 8079 (8602) 39.9% (42.5%) 29.1 15.80sec 132942 105822 26570 0 26570 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 29.08 136.66 0.00 0.00 1.2563 0.0000 3630924.72 3692659.32 1.67 105822.30 105822.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.66 100.00% 26569.63 0 131646 26711.86 20308 34214 3630925 3692659 1.67
HPS Timeline Chart

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:18300.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:!cooldown.rapture.remains
  • id:17
  • name:Power Word: Shield
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:1.870900
  • base_dd_min:19428.31
  • base_dd_max:19428.31
power_word_shield_glyph 523 2.6% 29.1 15.80sec 8098 0 7123 12412 8098 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.08 29.08 0.00 0.00 0.0000 0.0000 235504.78 874684.29 73.08 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.72 81.57% 7122.70 0 26329 7108.64 408 15130 168972 602363 71.95
crit 5.36 18.43% 12411.70 0 52658 12363.83 0 52658 66533 272321 75.57
HPS Timeline Chart

Action details: power_word_shield_glyph

Static Values
  • id:55672
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:55672
  • name:Glyph of Power Word: Shield
  • school:physical
  • tooltip:(null)
  • description:$55672s1% of the absorb from your Power Word: Shield spell is converted into healing.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:25115.29
  • base_dd_max:25115.29
power_word_shield_glyph_divine_aegis 0 0.0% 1.7 118.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 1.72 1.72 0.00 0.00 0.0000 0.0000 0.00 29355.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.72 100.00% 0.00 0 0 0.00 0 0 0 29356 100.00
HPS Timeline Chart

Action details: power_word_shield_glyph_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:15069.00
  • base_dd_max:15069.00
renew 1663 8.2% 25.9 17.40sec 28897 22897 0 0 0 0.0% 0.0% 0.0% 0.0% 105.2 6197 11144 7108 18.4% 0.0% 56.9%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 25.89 25.89 105.24 105.24 1.2620 2.4332 748100.72 2572236.73 70.92 2590.89 22897.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.8 81.57% 6196.62 0 21378 6186.44 2536 9764 531949 1771388 69.97
crit 19.4 18.43% 11144.03 0 42756 11145.61 0 33775 216151 800848 73.01
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:!dot.renew.ticking&mana>20000
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
renew_divine_aegis 0 0.0% 19.4 22.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: renew_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 19.40 19.40 0.00 0.00 0.0000 0.0000 0.00 95452.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.40 100.00% 0.00 0 0 0.00 0 0 0 95453 100.00
HPS Timeline Chart

Action details: renew_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
pet - mindbender 9661 / 2297
melee 9661 57.6% 87.5 4.51sec 11825 9970 11395 24327 11825 18.4% 16.7% 6.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.45 87.45 0.00 0.00 1.1861 0.0000 1034130.17 1034130.17 0.00 9969.63 9969.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.55 58.95% 11394.98 0 63774 11386.72 4901 17254 587417 587417 0.00
crit 16.05 18.36% 24327.47 -0 165544 24269.96 2400 42553 390512 390512 0.00
glance 5.22 5.97% 10756.45 -0 39181 10679.61 0 21561 56200 56200 0.00
dodge 11.99 13.71% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.63 3.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.667000
  • base_dd_min:1398.75
  • base_dd_max:1398.75
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 21.5 19.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.46 21.46 0.00 0.00 1.3006 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 21.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.1sec 181.1sec 6.65% 5.43%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.69%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
inner_focus 14.9 0.0 31.2sec 32.0sec 11.39% 21.27%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_focus
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_focus_1:11.4%

Spelldata details

  • id:89485
  • name:Inner Focus
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:45.00
  • default_chance:0.00%
jade_spirit 7.9 0.0 59.4sec 59.4sec 20.85% 22.10%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:20.8%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.0%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:(null)
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mindbender-shadowcrawl 21.5 0.0 19.0sec 19.0sec 85.38% 86.18%

Buff details

  • buff initial source:Priest_Disc_T14H_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:20.3%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%


Resource Usage Type Count Total Average RPE APR
greater_heal Mana 69.4 1163492.5 16759.0 16759.0 1.9
penance_heal Mana 65.2 605976.1 9300.0 9300.0 3.8
power_word_shield Mana 29.1 532228.4 18300.0 18300.0 7.3
renew Mana 25.9 201930.1 7800.0 7800.0 3.7
Resource Gains Type Count Total Average Overflow
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1799.52 971488.88 539.86 0.00 0.00%
mindbender Mana 72.83 873932.16 12000.00 0.00 0.00%
Rapture Mana 29.08 358288.39 12319.29 12582.00 3.39%
Resource RPS-Gain RPS-Loss
Mana 4963.73 5563.53
Combat End Resource Mean Min Max
Health 458421.00 458421.00 458421.00
Mana 30083.26 30.48 113948.08
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %


Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 25000
Mean 450.01
Minimum 360.03
Maximum 539.99
Spread ( max - min ) 179.96
Range [ ( max - min ) / 2 * 100% ] 19.99%


Sample Data
Count 25000
Mean 3987.55
Minimum 2292.86
Maximum 5765.28
Spread ( max - min ) 3472.42
Range [ ( max - min ) / 2 * 100% ] 43.54%
Standard Deviation 493.6846
5th Percentile 3195.86
95th Percentile 4818.38
( 95th Percentile - 5th Percentile ) 1622.52
Mean Distribution
Standard Deviation 3.1223
95.00% Confidence Intervall ( 3981.43 - 3993.67 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 588
0.1% Error 58881
0.1 Scale Factor Error with Delta=300 2080
0.05 Scale Factor Error with Delta=300 8322
0.01 Scale Factor Error with Delta=300 208057
Distribution Chart


Sample Data
Count 25000
Mean 3987.55


Sample Data
Count 25000
Mean 761088.28


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 20230.27
Minimum 15888.83
Maximum 25382.59
Spread ( max - min ) 9493.76
Range [ ( max - min ) / 2 * 100% ] 23.46%
Standard Deviation 1216.6075
5th Percentile 18241.56
95th Percentile 22242.00
( 95th Percentile - 5th Percentile ) 4000.44
Mean Distribution
Standard Deviation 7.6945
95.00% Confidence Intervall ( 20215.19 - 20245.35 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13892
0.1 Scale Factor Error with Delta=300 12635
0.05 Scale Factor Error with Delta=300 50541
0.01 Scale Factor Error with Delta=300 1263527
Distribution Chart


Sample Data
Count 25000
Mean 20230.27


Sample Data
Count 25000
Mean 9099731.03


Sample Data
Count 25000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 25000
Mean 215.92
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=75
6 7.25 shadowfiend,if=mana.pct<=20
7 0.00 hymn_of_hope,
8 2.99 berserking
9 14.87 inner_focus
A 0.00 power_infusion,if=talent.power_infusion.enabled
B 29.08 power_word_shield,if=!cooldown.rapture.remains
C 65.16 penance_heal,if=buff.grace.down
D 14.82 greater_heal,if=buff.inner_focus.up
E 0.00 penance_heal
F 25.89 renew,if=!dot.renew.ticking&mana>20000
G 54.86 greater_heal,if=mana>20000

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.40% 34.90% 3577


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo







# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "Priest_Disc_T14H": HitRating=-0.38, MasteryRating=-0.40 )
Zero Hit/Expertise ( Pawn: v1: "Priest_Disc_T14H": HitRating=0.00, MasteryRating=-0.40 )
RhadaTip Standard ( RhadaTip: "Priest_Disc_T14H": HitRating=-0.38, MasteryRating=-0.40 )
Zero Hit/Expertise ( RhadaTip: "Priest_Disc_T14H": HitRating=0.00, MasteryRating=-0.40 )

Priest_Holy_T14H : 13089 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
1183.5 1183.5 4.10 / 0.35% 547 / 46.3% 0.0 13088.7 13088.7 17.16 / 0.13% 2302 / 17.6% 3.8 3436.3 2875.4 Mana 0.27% 36.8 100.0%
  • circle_of_healing
  • prayer_of_mending
  • renew
Scale Factors for Priest_Holy_T14H's healing per second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 0.00 0.00 0.00 -0.48 0.00 0.00 -0.45
Normalized 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.00 0.00 0.00 0.02 0.00 0.00 0.02
Gear Ranking

Charts,s,333333&chd=t:18691|10728|9576|9356&chds=0,37382&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++18691++greater_heal,F58CBA,0,0,15|t++10728++flash_heal,F58CBA,1,0,15|t++9576++holy_word_serenity,F58CBA,2,0,15|t++9356++heal,F58CBA,3,0,15&chtt=Priest_Holy_T14H Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:47,23,9,8,6,6&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=heal|renew|greater_heal|holy_word_serenity|flash_heal|echo_of_light&chtt=Priest_Holy_T14H Healing Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:mmjhfgfehfgiijghedjhkhfgghjjljjllmnorqsqtvvy001yyxwxwwzxxsrpliedcaacccaaaYZXXbdfhimnpqsttvxz23444665767544220yzxwvtsqpolliggeeddedfffiijlmoprstvwxyz0zz000000zyywxvuustrqqppolljigeeccbbbZYYXYXXXWXXXYYabcdefhikmnpqstvyz233566656544220zzwvtqpmljhihhgghggggihijjlmmpqrssuuvwwzz012333445423220yywvtqqommkjgfeccbabbcccedeffgghjkmmnpprqqsstuuwwyyy000112100zzxwwttrpomljggeedccccddeddeefghjkmnnpqrtuwwwy023466777876654200xxvsronljiggededdeegghjjlllnopqqrrrsrtsssstsstuwvvwwxwwxwxwvvtsrppmljiigffeggfhgijkmmopqsssuuvuuvuvuuututttttututtttutuutuutut&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=539|1:|0|avg=1183|max=19029&chxp=1,1,6,100&chtt=Priest_Holy_T14H DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,20,8,16,44,56,60,96,180,208,220,412,516,492,672,832,944,964,1188,1252,1388,1432,1476,1624,1372,1300,1256,1036,1016,916,864,696,508,388,376,336,240,176,116,116,60,40,28,20,4,4,16,0,4,8&chds=0,1624&chbh=5&chxt=x&chxl=0:|min=8461|avg=13089|max=18486&chxp=0,1,46,100&chtt=Priest_Holy_T14H HPS Distribution&chts=dddddd,18,s,333333&chd=t:66.4,11.2,7.7,6.4,5.3,1.9,0.8,0.3&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,9482C9,ffffff&chl=heal 298.6s|holy_word_serenity 50.3s|flash_heal 34.5s|greater_heal 28.9s|renew 23.8s|hymn_of_hope 8.8s|shadowfiend 3.4s|waiting 1.2s&chtt=Priest_Holy_T14H Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Holy_T14H 1183
berserking 0 0.0% 3.0 181.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
chakra 0 0.0% 14.9 31.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.93 14.93 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: chakra

Static Values
  • id:81208
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:
  • id:81208
  • name:Chakra: Serenity
  • school:holy
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
echo_of_light 778 6.0% 83.7 5.29sec 4190 0 0 0 0 0.0% 0.0% 0.0% 0.0% 302.4 1160 0 1160 0.0% 0.0% 67.2%

Stats details: echo_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 83.75 83.75 302.43 302.43 0.0000 1.0000 350892.41 981405.23 64.25 1160.24 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 302.4 100.00% 1160.24 0 19177 1157.28 587 1915 350892 981405 64.25
HPS Timeline Chart

Action details: echo_of_light

Static Values
  • id:77489
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:77489
  • name:Echo of Light
  • school:holy
  • tooltip:Healing $w every sec.
  • description:Heals every sec for $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:5729.43
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
flash_heal 820 6.3% 27.0 16.08sec 13665 10728 11718 15706 13665 48.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flash_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 27.04 27.04 0.00 0.00 1.2738 0.0000 369574.44 3042318.98 87.85 10727.85 10727.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.84 51.17% 11718.33 0 78380 11605.74 0 44024 162161 1045910 84.50
crit 13.21 48.83% 15705.52 0 156759 15606.72 0 67929 207413 1996409 89.61
HPS Timeline Chart

Action details: flash_heal

Static Values
  • id:2061
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:buff.surge_of_light.up
  • id:2061
  • name:Flash Heal
  • school:holy
  • tooltip:(null)
  • description:Heals a friendly target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.642000
  • base_dd_min:15767.86
  • base_dd_max:18324.82
greater_heal 1216 9.2% 24.5 9.54sec 22081 18691 19768 24791 22081 46.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 24.45 24.45 0.00 0.00 1.1814 0.0000 539979.87 3593609.64 84.97 18690.89 18690.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.20 53.96% 19768.06 0 104529 19888.34 0 77343 260840 1327684 80.35
crit 11.26 46.04% 24791.07 0 209058 25047.41 0 120890 279139 2265926 87.68
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:buff.serendipity.react>=2&mana.pct>40
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
heal 6192 47.4% 142.5 3.14sec 19611 9356 15408 25016 19611 43.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 142.47 142.47 0.00 0.00 2.0961 0.0000 2794073.41 9656995.23 71.07 9356.15 9356.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.15 56.25% 15408.19 0 48894 15380.39 6885 26003 1234911 3778935 67.32
crit 62.33 43.75% 25016.09 0 97789 24974.04 8647 42265 1559163 5878061 73.47
HPS Timeline Chart

Action details: heal

Static Values
  • id:2050
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:2050
  • name:Heal
  • school:holy
  • tooltip:(null)
  • description:Heal your target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.024000
  • base_dd_min:9847.03
  • base_dd_max:11443.84
holy_word_serenity 1067 8.2% 39.6 11.49sec 12168 9576 10505 15482 12168 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_word_serenity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.55 39.55 0.00 0.00 1.2707 0.0000 481245.20 3153378.15 84.74 9576.07 9576.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.34 66.59% 10505.38 0 62001 10484.73 0 27482 276680 1573870 82.42
crit 13.21 33.41% 15481.99 0 124002 15465.19 0 76069 204565 1579508 87.05
HPS Timeline Chart

Action details: holy_word_serenity

Static Values
  • id:88684
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:buff.chakra_serenity.up
  • id:88684
  • name:Holy Word: Serenity
  • school:holy
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.300000
  • base_dd_min:12366.55
  • base_dd_max:14517.25
renew 3015 23.0% 18.8 24.24sec 72067 57118 0 0 0 0.0% 0.0% 0.0% 0.0% 173.6 5699 10504 7820 44.2% 0.0% 94.8%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 18.84 18.84 173.64 173.64 1.2617 2.4571 1357975.42 4564467.23 70.25 3014.84 57117.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.0 55.85% 5698.93 0 18911 5690.65 2158 9974 552667 1768283 68.75
crit 76.7 44.15% 10503.95 0 37823 10491.50 3784 21111 805309 2796184 71.20
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:-0.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:!ticking
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowfiend 0 0.0% 2.8 181.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.78 2.78 0.00 0.00 1.2378 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:mana.pct<=65
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
pet - shadowfiend 16143 / 1183
melee 16141 100.0% 27.8 12.37sec 19131 17528 18471 39381 19131 18.2% 16.7% 6.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.83 27.83 0.00 0.00 1.0915 0.0000 532441.66 532441.66 0.00 17527.79 17527.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.46 59.12% 18471.37 -0 83243 18469.61 0 32478 303947 303947 0.00
crit 5.06 18.18% 39381.31 0 74722 39226.39 0 67766 199295 199295 0.00
glance 1.67 6.00% 17497.57 0 80746 14295.25 0 80746 29200 29200 0.00
dodge 3.80 13.64% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.85 3.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.5 72.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.53 5.53 0.00 0.00 1.2413 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
stormlash 2 0.0% 0.1 1.52sec 405 0 363 721 405 17.1% 5.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.14 0.14 0.00 0.00 0.0000 0.0000 55.97 55.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.11 77.64% 362.77 219 388 8.06 0 388 39 39 0.00
crit 0.02 17.15% 721.40 438 776 10.51 0 776 17 17 0.00
miss 0.01 5.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:(null)
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:486.72
  • base_dd_max:486.72


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.1sec 181.1sec 6.65% 6.31%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.06%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
hymn_of_hope 1.0 4.0 0.0sec 1.7sec 3.33% 3.33%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_hymn_of_hope
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • hymn_of_hope_1:3.3%

Spelldata details

  • id:64904
  • name:Hymn of Hope
  • tooltip:Maximum mana increased by $s2%.
  • description:Restores $64904s1% mana to $64901s2 nearby low mana friendly party or raid targets every $64901t1 sec for $64901d, and increases their total maximum mana by $64904s2% for $64904d. Maximum of $*4;s2 mana restores. The Priest must channel to maintain the spell.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
jade_spirit 8.4 0.0 55.8sec 55.8sec 22.25% 22.60%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.2%
serendipity 9.0 18.0 49.9sec 16.1sec 70.93% 70.93%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serendipity
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • serendipity_1:22.5%
  • serendipity_2:48.4%

Spelldata details

  • id:63735
  • name:Serendipity
  • tooltip:Reduces the cast time of your next Greater Heal or Prayer of Healing by $s1% and mana cost by $s2%.
  • description:When you heal with Binding Heal or Flash Heal, the cast time of your next Greater Heal or Prayer of Healing spell is reduced by $63735s1% and mana cost reduced by $63735s2%. Stacks up to 2 times. Lasts $63735d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
serenity 39.5 0.0 11.5sec 11.5sec 52.35% 38.62%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serenity
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • serenity_1:52.3%

Spelldata details

  • id:88684
  • name:Holy Word: Serenity
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
  • max_stacks:
  • duration:6.00
  • cooldown:10.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.0%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:(null)
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
surge_of_light 27.1 2.0 16.0sec 14.9sec 8.11% 100.00%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_surge_of_light
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_light_1:6.4%
  • surge_of_light_2:1.7%

Spelldata details

  • id:114255
  • name:Surge of Light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • description:You have a $109186s1% chance when you Smite, Heal, Flash Heal, Binding Heal or Greater Heal to cause your next Flash Heal to be instant cast and have no mana cost. Limit 2 charges.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
shadowfiend-shadowcrawl 5.5 0.0 72.5sec 72.5sec 83.35% 85.93%

Buff details

  • buff initial source:Priest_Holy_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:6.1%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stormlash 0.0 0.0 0.0sec 0.0sec 0.65% 0.65%

Buff details

  • buff initial source:Priest_Holy_T14H_shadowfiend
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:0.0%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:(null)
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_chakra_serenity
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • chakra_serenity_1:100.0%

Spelldata details

  • id:81208
  • name:Chakra: Serenity
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:30.00
  • default_chance:1.00%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%


Resource Usage Type Count Total Average RPE APR
greater_heal Mana 24.5 349980.3 14311.4 14311.4 1.5
heal Mana 142.5 812095.0 5700.0 5700.0 3.4
holy_word_serenity Mana 39.6 237300.5 6000.0 6000.0 2.0
renew Mana 18.8 146978.2 7800.0 7800.0 9.2
Resource Gains Type Count Total Average Overflow
hymn_of_hope_max_mana Mana 1.00 44964.00 45000.00 0.00 0.00%
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1799.52 968951.54 538.45 0.00 0.00%
shadowfiend Mana 23.18 216437.40 9335.44 0.00 0.00%
hymn_of_hope Mana 5.00 33573.12 6720.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 2875.35 3436.29
Combat End Resource Mean Min Max
Health 458421.00 458421.00 458421.00
Mana 47573.15 6.40 183386.13
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %


Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 25000
Mean 450.01
Minimum 360.03
Maximum 539.99
Spread ( max - min ) 179.96
Range [ ( max - min ) / 2 * 100% ] 19.99%


Sample Data
Count 25000
Mean 1183.48
Minimum 50.61
Maximum 2440.23
Spread ( max - min ) 2389.63
Range [ ( max - min ) / 2 * 100% ] 100.96%
Standard Deviation 330.5428
5th Percentile 662.90
95th Percentile 1757.75
( 95th Percentile - 5th Percentile ) 1094.86
Mean Distribution
Standard Deviation 2.0905
95.00% Confidence Intervall ( 1179.38 - 1187.57 )
Normalized 95.00% Confidence Intervall ( 99.65% - 100.35% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 2996
0.1% Error 299663
0.1 Scale Factor Error with Delta=300 932
0.05 Scale Factor Error with Delta=300 3730
0.01 Scale Factor Error with Delta=300 93269
Distribution Chart


Sample Data
Count 25000
Mean 1183.48


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 13088.74
Minimum 8461.44
Maximum 18486.37
Spread ( max - min ) 10024.93
Range [ ( max - min ) / 2 * 100% ] 38.30%
Standard Deviation 1383.9757
5th Percentile 10832.24
95th Percentile 15436.20
( 95th Percentile - 5th Percentile ) 4603.97
Mean Distribution
Standard Deviation 8.7530
95.00% Confidence Intervall ( 13071.58 - 13105.89 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 429
0.1% Error 42949
0.1 Scale Factor Error with Delta=300 16350
0.05 Scale Factor Error with Delta=300 65403
0.01 Scale Factor Error with Delta=300 1635085
Distribution Chart


Sample Data
Count 25000
Mean 13088.74


Sample Data
Count 25000
Mean 5893740.74


Sample Data
Count 25000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 25000
Mean 275.79
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=50
6 2.78 shadowfiend,if=mana.pct<=65
7 1.00 hymn_of_hope,<=40
8 2.99 berserking
9 14.93 chakra_serenity
A 18.84 renew,if=!ticking
B 39.55 holy_word,if=buff.chakra_serenity.up
C 24.46 greater_heal,if=buff.serendipity.react>=2&mana.pct>40
D 27.04 flash_heal,if=buff.surge_of_light.up
E 143.19 heal

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.70% 17.45% 3577


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo







# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "Priest_Holy_T14H": HitRating=-0.48, MasteryRating=-0.45 )
Zero Hit/Expertise ( Pawn: v1: "Priest_Holy_T14H": HitRating=0.00, MasteryRating=-0.45 )
RhadaTip Standard ( RhadaTip: "Priest_Holy_T14H": HitRating=-0.48, MasteryRating=-0.45 )
Zero Hit/Expertise ( RhadaTip: "Priest_Holy_T14H": HitRating=0.00, MasteryRating=-0.45 )

Warrior_Protection_T14H : 122381 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
122380.6 122380.6 50.75 / 0.04% 6761 / 5.5% 15037.7 7836.6 7836.6 14.21 / 0.18% 1890 / 24.1% 963.0 8.1 8.3 Rage 0.00% 54.8 100.0%
Origin non
  • hold_the_line
  • unending_rage
  • heavy_repercussions
Scale Factors for Warrior_Protection_T14H's damage taken per second
Str Agi Sta AP Exp InvExp Hit Crit Haste Mastery Wdps Armor Dodge Parry BlockR
Scale Factors 0.00 0.00 0.00 0.00 -0.79 0.00 -0.87 0.00 0.00 -0.83 0.00 0.00 -0.42 -0.35 0.00
Normalized 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1000 1000 1000 1000 -1000 1000 -1000 1000 1000 1000 300 10000 1000 1000 1000
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Gear Ranking

Charts,s,333333&chd=t:138342|82939|51292|50347|15253&chds=0,276683&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++138342++shield_slam,C79C6E,0,0,15|t++82939++revenge,C79C6E,1,0,15|t++51292++devastate,C79C6E,2,0,15|t++50347++thunder_clap,C79C6E,3,0,15|t++15253++melee_main_hand,C79C6E,4,0,15&chtt=Warrior_Protection_T14H Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:32,17,17,16,12,2,2,2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,ABD473&chl=shield_slam|devastate|deep_wounds|revenge|melee_main_hand|heroic_strike|thunder_clap|stormlash&chtt=Warrior_Protection_T14H Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:cadfeghgikjlloqqtrqrrprqoqpnpnmnmnnlnmlnnlnomppnppoqppqoqpnpqoqqoqqoqqoqqprprsqstrttrttrtusuusutuusvvsvusvvtvvtvvuwvvvtuvsuusuvsvusuusuutvuvwuwxuxxvxxvxxvxxwxwwxvxxvxxuxxvyyw0zy100101202314536524313223122022z21y00x00y0zy0yz0yz0x0zx00x00y00y0yyzxyywyxvyyvyxvxwvxwwyxxywyzxzzwzzwzyxzyxzxyzxyzwyywyyw00z221322313424536758635424323223011y0zwyxvyxvxwwxwwxvwxvyzx00y1102213223234132z10xzzwyxwxwvxvvwuvvtvvtvvtwwuwvuwuvwuwwvwwuxxuxwuwvuwuuvtuvsuusuusutsutsuutvtuvtuvtvvtvvtvvuvvuvuuwuvwuwwuwwuwvuvvtvututuustusuvtvvtvvuwvvxwwxvxxvxxuwwtvutvututst&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=539|1:|0|avg=122381|max=152392&chxp=1,1,80,100&chtt=Warrior_Protection_T14H DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,4,8,16,48,28,48,88,144,132,220,300,336,504,528,632,704,848,924,1140,1368,1212,1448,1448,1460,1464,1404,1168,1040,1048,964,900,688,636,480,424,332,228,204,148,80,72,32,44,12,16,12,0,4,4&chds=0,1464&chbh=5&chxt=x&chxl=0:|min=108234|avg=122381|max=137387&chxp=0,1,49,100&chtt=Warrior_Protection_T14H DPS Distribution&chts=dddddd,18,s,333333&chd=t:41.1,27.9,23.6,4.9,2.6&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=devastate 185.1s|shield_slam 125.4s|revenge 106.4s|thunder_clap 22.1s|battle_shout 11.7s&chtt=Warrior_Protection_T14H Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Protection_T14H 122381
avatar 0 0.0% 3.0 181.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.avatar.enabled
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Physical damage increased by $s1%. Attacks generate $s4% extra Rage. Immune to movement impairing effects.
  • description:You transform into an unstoppable colossus for $d, increasing your damage dealt by $s1% and causing your attacks to generate $s4% extra Rage. While transformed you are immune to movement impairing effects.
battle_shout 0 0.0% 7.6 62.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.64 7.64 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<100
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 15.4 30.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
deep_wounds 20487 16.7% 197.3 2.28sec 46741 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.9 57864 115795 61940 7.0% 0.0% 99.3%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.31 197.31 148.89 148.89 0.0000 3.0000 9222259.49 9222259.49 0.00 20646.60 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.4 92.96% 57863.87 8807 90553 57852.96 50424 64826 8009249 8009249 0.00
crit 10.5 7.04% 115794.77 17615 177500 115720.74 0 140634 1213010 1213010 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
demoralizing_shout 0 0.0% 7.6 63.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.55 7.55 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:Demoralized, dealing $s1% less damage to the shouting Warrior.
  • description:Demoralizes all enemies within $A1 yards, reducing the damage they do to you by $s1% for $d.
devastate 21096 17.2% 120.5 3.67sec 78811 51292 81670 163354 78811 6.4% 9.9% 0.0% 4.2% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.49 120.49 0.00 0.00 1.5365 0.0000 9496329.14 9496329.14 0.00 51292.42 51292.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.79 79.49% 81669.81 30334 119667 81632.26 74443 88743 7822779 7822779 0.00
crit 7.71 6.40% 163353.82 66759 236733 163140.89 0 207195 1258870 1258870 0.00
block 5.07 4.21% 81740.72 33379 117569 81218.83 0 114453 414680 414680 0.00
parry 9.07 7.53% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 2.79 2.31% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:(null)
  • description:Deals $m1% weapon damage plus ${$m2*$m1/100} and sunders the target, causing Weakened Armor. Replaces Sunder Armor. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1657.58
  • base_dd_max:1657.58
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20
heroic_strike 2606 2.1% 22.0 19.82sec 53268 0 55188 110177 53268 6.3% 9.8% 0.0% 4.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 0.0000 0.0000 1172882.66 1172882.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.53 79.62% 55187.86 19729 81140 55176.73 46328 63327 967545 967545 0.00
crit 1.39 6.33% 110177.40 39457 158863 82212.43 0 152488 153596 153596 0.00
block 0.94 4.25% 55251.42 19721 78438 33332.24 0 78438 51742 51742 0.00
parry 1.63 7.40% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.52 2.34% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ultimatum.up
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
melee_main_hand 15216 12.4% 199.9 2.25sec 34258 15253 37580 75105 34258 7.0% 9.8% 24.0% 3.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.85 199.85 0.00 0.00 2.2460 0.0000 6846609.69 6846609.69 0.00 15253.19 15253.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.39 56.24% 37580.02 12728 56497 37573.09 33611 41382 4223658 4223658 0.00
crit 14.00 7.01% 75104.85 25456 112379 75096.68 0 88493 1051540 1051540 0.00
glance 47.87 23.95% 28177.45 9546 42373 28175.30 24400 31848 1348721 1348721 0.00
block 5.93 2.96% 37582.10 12728 54916 37386.91 0 52131 222691 222691 0.00
parry 14.94 7.48% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 4.60 2.30% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.13 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revenge 19604 16.0% 69.2 6.51sec 127435 82939 132119 263942 127435 6.3% 9.8% 0.0% 4.2% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.23 69.23 0.00 0.00 1.5365 0.0000 8822588.51 8822588.51 0.00 82939.33 82939.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.16 79.68% 132119.29 20076 266225 132171.31 113185 150348 7288292 7288292 0.00
crit 4.35 6.29% 263941.83 40191 522471 260422.23 0 435062 1149435 1149435 0.00
block 2.92 4.22% 131679.29 20076 255190 124604.74 0 238216 384862 384862 0.00
parry 5.18 7.49% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 1.57 2.26% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:9.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:rage<100
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:(null)
  • description:Instantly attack an enemy and two additional enemies for $s1 damage. A successful dodge or parry will reset the cooldown on Revenge. Generates $/10;s2 Rage in Defensive Stance.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:3365.01
  • base_dd_max:4112.79
shield_barrier 7837 100.0% 14.7 29.25sec 239213 0 48442 0 48442 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_barrier

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 14.74 72.79 0.00 0.00 0.0000 0.0000 3526312.06 5177936.11 31.90 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.79 100.00% 48442.29 0 247848 48605.66 31146 71873 3526312 5177936 31.90
HPS Timeline Chart

Action details: shield_barrier

Static Values
  • id:112048
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:buff.shield_barrier.down&rage>80
  • id:112048
  • name:Shield Barrier
  • school:physical
  • tooltip:Absorbs $w1 damage.
  • description:Raise your shield, absorbing $<absorb> damage for the next $d. Consumes up to 60 Rage to increase the amount absorbed. Absorption amount increases with attack power.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:250.00
  • base_dd_max:250.00
shield_block 0 0.0% 50.5 8.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.50 50.50 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 50.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:9.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:(null)
  • description:Raise your shield, blocking every melee attack against you for $132404d. These blocks can be critical blocks.
shield_slam 38553 31.5% 81.6 5.54sec 212561 138342 220560 440818 212561 6.3% 9.9% 0.0% 4.2% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.63 81.63 0.00 0.00 1.5365 0.0000 17351366.05 17351366.05 0.00 138341.67 138341.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.99 79.62% 220559.57 28145 387259 220497.37 191391 246452 14335208 14335208 0.00
crit 5.12 6.28% 440817.70 56290 758514 437671.82 0 671146 2258679 2258679 0.00
block 3.44 4.21% 220515.31 28145 378263 213718.30 0 361250 757479 757479 0.00
parry 6.12 7.49% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 1.91 2.34% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:rage<90
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:(null)
  • description:Slam the target with your shield, causing $s1 damage$?s58375[ and dispelling 1 magical effect][]. Generates $/10;s3 Rage in Defensive Stance.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:4560.42
  • base_dd_max:4794.29
shield_wall 0 0.0% 3.6 134.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shield_wall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 3.57 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shield_wall

Static Values
  • id:871
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shield_block.down
  • id:871
  • name:Shield Wall
  • school:physical
  • tooltip:All damage taken reduced by $w1%.
  • description:Reduces all damage taken by $s1% for $d.
stormlash 2347 1.9% 37.7 8.70sec 27643 0 27784 54764 27643 2.0% 2.4% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.70 37.70 0.00 0.00 0.0000 0.0000 1042183.90 1042183.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.05 95.62% 27783.60 2873 57941 27784.92 20526 33791 1001650 1001650 0.00
crit 0.74 1.96% 54764.01 5746 112911 28610.67 0 112911 40534 40534 0.00
miss 0.91 2.41% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormlash

Static Values
  • id:120687
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.10
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120687
  • name:Stormlash
  • school:nature
  • tooltip:(null)
  • description:Deals Nature damage to enemy targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:18773.01
  • base_dd_max:18773.01
thunder_clap 2471 2.0% 14.4 32.05sec 77354 50347 72373 144169 77354 7.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: thunder_clap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.38 14.38 0.00 0.00 1.5364 0.0000 1112214.83 1112214.83 0.00 50346.97 50346.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.36 92.95% 72372.95 11133 113088 72346.07 61308 83221 967192 967192 0.00
crit 1.01 7.00% 144169.28 22267 225489 93200.92 0 225489 145023 145023 0.00
miss 0.01 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: thunder_clap

Static Values
  • id:6343
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.weakened_blows.down
  • id:6343
  • name:Thunder Clap
  • school:physical
  • tooltip:(null)
  • description:Blasts enemies within $6343A1 yards for $?s12712[${$6343m1*1.2}][$6343m1] damage and applies the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:311.57
  • base_dd_max:311.57


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
avatar 3.0 0.0 181.3sec 181.3sec 13.13% 14.06%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • avatar_1:13.1%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Physical damage increased by $s1%. Attacks generate $s4% extra Rage. Immune to movement impairing effects.
  • description:You transform into an unstoppable colossus for $d, increasing your damage dealt by $s1% and causing your attacks to generate $s4% extra Rage. While transformed you are immune to movement impairing effects.
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
berserker_rage 15.4 0.0 30.1sec 30.1sec 20.45% 20.45%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • berserker_rage_1:20.4%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.90%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_aegis 39.4 4.8 11.2sec 9.9sec 22.27% 69.19%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_divine_aegis
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • divine_aegis_1:22.3%

Spelldata details

  • id:47753
  • name:Divine Aegis
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
enrage 28.8 43.3 15.8sec 6.3sec 76.47% 76.44%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • enrage_1:76.5%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
grace 1.0 263.2 0.0sec 1.7sec 99.60% 99.52%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_grace
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • grace_1:0.2%
  • grace_2:0.2%
  • grace_3:99.3%
hold_the_line 17.0 2.0 25.2sec 22.4sec 19.94% 31.23%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_hold_the_line
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • hold_the_line_1:19.9%

Spelldata details

  • id:84619
  • name:Hold the Line
  • tooltip:Improves the damage of your next Revenge.
  • description:Improves the damages of Revenge by $84619s1% following a successful parry.
  • max_stacks:
  • duration:5.00
  • cooldown:0.00
  • default_chance:1.00%
power_word_shield 28.4 0.7 16.0sec 15.8sec 29.71% 100.00%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_power_word_shield
  • max_stacks:1
  • duration:15.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_word_shield_1:29.7%

Spelldata details

  • id:17
  • name:Power Word: Shield
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
  • max_stacks:
  • duration:15.00
  • cooldown:6.00
  • default_chance:0.00%
rivers_song 22.9 20.3 19.5sec 10.2sec 50.55% 48.92%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_rivers_song
  • max_stacks:2
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:dodge_rating
    • amount:1650.00

    Stack Uptimes

    • rivers_song_1:26.3%
    • rivers_song_2:24.3%
shield_barrier 14.7 0.0 29.2sec 29.2sec 18.24% 79.75%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_shield_barrier
  • max_stacks:1
  • duration:6.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shield_barrier_1:18.2%

Spelldata details

  • id:112048
  • name:Shield Barrier
  • tooltip:Absorbs $w1 damage.
  • description:Raise your shield, absorbing $<absorb> damage for the next $d. Consumes up to 60 Rage to increase the amount absorbed. Absorption amount increases with attack power.
  • max_stacks:
  • duration:6.00
  • cooldown:1.50
  • default_chance:0.00%
shield_block 43.4 0.0 10.4sec 10.4sec 66.85% 57.02%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shield_block_1:66.8%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by $s1%.
  • description:$@spelldesc2565
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
shield_wall 3.6 0.0 134.3sec 134.3sec 9.43% 19.44%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_shield_wall
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.40

Stack Uptimes

  • shield_wall_1:9.4%

Spelldata details

  • id:871
  • name:Shield Wall
  • tooltip:All damage taken reduced by $w1%.
  • description:Reduces all damage taken by $s1% for $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
stormlash 4.0 0.0 103.7sec 103.7sec 9.01% 9.01%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stormlash_1:9.0%

Spelldata details

  • id:120687
  • name:Stormlash
  • tooltip:(null)
  • description:Deals Nature damage to enemy targets.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stuff_of_nightmares 9.1 0.0 51.4sec 51.4sec 39.70% 39.70%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_stuff_of_nightmares
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:dodge_rating
    • amount:3653.00

    Stack Uptimes

    • stuff_of_nightmares_1:39.7%
sword_and_board 31.8 0.8 13.7sec 13.3sec 13.44% 39.78%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_sword_and_board
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

  • sword_and_board_1:13.4%

Spelldata details

  • id:50227
  • name:Sword and Board
  • tooltip:Shield Slam generates $/10;50227s1 more Rage.
  • description:Your Devastate has a $s1% chance of resetting the cooldown of your Shield Slam and increasing the Rage it generates by $/10;50227s1 for $50227d.
  • max_stacks:
  • duration:5.00
  • cooldown:0.00
  • default_chance:1.00%
ultimatum 22.0 0.0 19.8sec 19.8sec 0.00% 0.00%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_ultimatum
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.00

Stack Uptimes

Spelldata details

  • id:122510
  • name:Ultimatum
  • tooltip:Your next Heroic Strike or Cleave costs no Rage.
  • description:Your Shield Slam has a $122509h% chance to make your next Heroic Strike or Cleave cost no Rage.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
vial_of_dragons_blood 9.1 0.0 51.4sec 51.4sec 39.69% 39.69%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_vial_of_dragons_blood
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:dodge_rating
    • amount:3653.00

    Stack Uptimes

    • vial_of_dragons_blood_1:39.7%
weakened_soul 29.1 0.0 15.7sec 15.8sec 73.67% 77.08%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_weakened_soul
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • weakened_soul_1:73.7%

Spelldata details

  • id:6788
  • name:Weakened Soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • description:The target's soul is weakened by the force of Power Word: Shield, and cannot be shielded again for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:Warrior_Protection_T14H
  • cooldown name:buff_defensive_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • defensive_stance_1:100.0%

Spelldata details

  • id:7376
  • name:Defensive Stance Passive
  • tooltip:(null)
  • description:Decreases damage taken by $7376s1%. Threat generation significantly increased. Generates 1 Rage every 3 sec while in combat.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%


Resource Usage Type Count Total Average RPE APR
shield_barrier Rage 14.7 884.5 60.0 60.0 3986.9
shield_block Rage 50.5 2777.4 55.0 55.0 0.0
Resource Gains Type Count Total Average Overflow
battle_shout Rage 7.64 169.23 22.14 0.40 0.24%
critical_block Rage 56.70 586.45 10.34 2.91 0.49%
defensive_stance Rage 1799.52 149.70 0.08 0.27 0.18%
enrage Rage 15.43 156.89 10.17 0.41 0.26%
revenge Rage 62.44 972.21 15.57 0.00 0.00%
shield_slam Rage 73.55 1684.98 22.91 0.02 0.00%
Resource RPS-Gain RPS-Loss
Health 25311.70 25306.88
Rage 8.27 8.14
Combat End Resource Mean Min Max
Health 559218.26 163541.92 584939.00
Rage 57.57 0.25 120.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %


Count Interval
parry_haste 14.9 28.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 25000
Mean 450.01
Minimum 360.03
Maximum 539.99
Spread ( max - min ) 179.96
Range [ ( max - min ) / 2 * 100% ] 19.99%


Sample Data
Count 25000
Mean 122380.60
Minimum 108233.52
Maximum 137387.23
Spread ( max - min ) 29153.70
Range [ ( max - min ) / 2 * 100% ] 11.91%
Standard Deviation 4093.9653
5th Percentile 115577.51
95th Percentile 129099.29
( 95th Percentile - 5th Percentile ) 13521.78
Mean Distribution
Standard Deviation 25.8925
95.00% Confidence Intervall ( 122329.85 - 122431.35 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4298
0.1 Scale Factor Error with Delta=300 143077
0.05 Scale Factor Error with Delta=300 572310
0.01 Scale Factor Error with Delta=300 14307771
Distribution Chart


Sample Data
Count 25000
Mean 122380.60


Sample Data
Count 25000
Mean 55066434.27


Sample Data
Count 25000
Mean 25297.07


Sample Data
Count 25000
Mean 7836.64
Minimum 3410.09
Maximum 11893.78
Spread ( max - min ) 8483.69
Range [ ( max - min ) / 2 * 100% ] 54.13%
Standard Deviation 1146.0664
5th Percentile 5958.97
95th Percentile 9739.85
( 95th Percentile - 5th Percentile ) 3780.88
Mean Distribution
Standard Deviation 7.2484
95.00% Confidence Intervall ( 7822.44 - 7850.85 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 821
0.1% Error 82159
0.1 Scale Factor Error with Delta=300 11212
0.05 Scale Factor Error with Delta=300 44850
0.01 Scale Factor Error with Delta=300 1121252
Distribution Chart


Sample Data
Count 25000
Mean 7836.64


Sample Data
Count 25000
Mean 3526312.06


Sample Data
Count 25000
Mean 25239.68

#Executed Foreground Actions

Sample Data
Count 25000
Mean 411.18
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# count action,conditions
0 0.00 flask,type=earth
1 0.00 food,type=pearl_milk_tea
2 0.00 snapshot_stats
3 0.00 stance,choose=defensive
Default action list
# count action,conditions
4 1.00 auto_attack
5 2.99 avatar,if=talent.avatar.enabled
6 15.43 berserker_rage,use_off_gcd=1
7 22.02 heroic_strike,if=buff.ultimatum.up,use_off_gcd=1
8 81.63 shield_slam,if=rage<90
9 69.23 revenge,if=rage<100
A 7.64 battle_shout,if=rage<100
B 50.50 shield_block,
C 14.74 shield_barrier,if=buff.shield_barrier.down&rage>80
D 3.57 shield_wall,if=buff.shield_block.down
E 7.55 demoralizing_shout
F 14.38 thunder_clap,if=target.debuff.weakened_blows.down
G 120.49 devastate

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 12558 11960 11754
Agility 222 211 80
Stamina 31324 26665 21895
Intellect 124 118 80
Spirit 149 149 80
Health 584939 519713 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 12.64% 12.64% 2530
Spell Crit 5.01% 0.01% 0
Spell Haste 5.00% 0.00% 0
Mana Per 5 0 0 0
Attack Power 27870 24140 0
Melee Hit 7.44% 7.44% 2530
Melee Crit 10.02% 5.02% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 10.00% 0.00% 0
Expertise 5.20% 5.20% 1768
Armor 65271 65271 52217
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 6.58% 6.58% 4051
Tank-Parry 13.81% 13.62% 4459
Tank-Block 61.92% 53.43% 0
Tank-Crit 0.00% 0.00% 0
Mastery 68.82% 56.36% 10569


15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt







# Gear Summary
# gear_strength=11754
# gear_agility=80
# gear_stamina=21895
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=1768
# gear_hit_rating=2530
# gear_mastery_rating=10569
# gear_armor=52217
# gear_dodge_rating=4051
# gear_parry_rating=4459
# meta_gem=austere_primal
# tier14_2pc_tank=1
# tier14_4pc_tank=1
# main_hand=scimitar_of_seven_stars,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rivers_song

Gear Weights

Pawn Standard ( Pawn: v1: "Warrior_Protection_T14H": ExpertiseRating=-0.79, HitRating=-0.87, MasteryRating=-0.83 )
Zero Hit/Expertise ( Pawn: v1: "Warrior_Protection_T14H": ExpertiseRating=0.00, HitRating=0.00, MasteryRating=-0.83 )
RhadaTip Standard ( RhadaTip: "Warrior_Protection_T14H": ExpertiseRating=-0.79, HitRating=-0.87, MasteryRating=-0.83 )
Zero Hit/Expertise ( RhadaTip: "Warrior_Protection_T14H": ExpertiseRating=0.00, HitRating=0.00, MasteryRating=-0.83 )

Healing Target : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active
0.0 0.0 Health 0.00% 0.0 100.0%
Scale Factors for Healing Target's damage taken per second
Str Agi Sta AP Exp InvExp Hit Crit Haste Mastery Wdps Armor Dodge
Scale Factors 0.00 0.00 0.00 0.00 -0.00 0.00 -0.00 0.00 0.00 0.00 0.00 0.00 0.00
Normalized 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1000 1000 1000 1000 -1000 1000 -1000 1000 1000 1000 300 10000 1000
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Gear Ranking




Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bleeding_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • health_decade_90__100_1:100.0%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%


Resource Usage Type Count Total Average RPE APR
Healing Target
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Combat End Resource Mean Min Max
Health 10000000.00 10000000.00 10000000.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %


Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 25000
Mean 450.01
Minimum 360.03
Maximum 539.99
Spread ( max - min ) 179.96
Range [ ( max - min ) / 2 * 100% ] 19.99%


Sample Data
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 0.00


Sample Data
Count 25000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 25000
Mean 0.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List


Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 100000000 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% nan% 0
Spell Haste inf% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 0.00% nan% 0
Melee Haste inf% 0.00% 0
Swing Speed inf% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 0 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0


Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty


15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none



unknown="Healing Target"

# Gear Summary

Gear Weights

Pawn Standard
Zero Hit/Expertise
RhadaTip Standard
Zero Hit/Expertise

Simulation & Raid Information

Iterations: 25000
Threads: 4
Confidence: 95.00
Fight Length: 360 - 540 ( 450.0 )


Total Events Processed: 350148584
Max Event Queue: 61
Sim Seconds: 11250169
CPU Seconds: 201.1590
Speed Up: 55927


World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
RNG global
RNG global: Actual ( Confidence Interval ): Roll=nan Range=nan nan

Simulation Length

Sample Data
Count 25000
Mean 450.01
Minimum 360.03
Maximum 539.99
Spread ( max - min ) 179.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 51.9563
5th Percentile 369.01
95th Percentile 531.00
( 95th Percentile - 5th Percentile ) 161.99
Mean Distribution
Standard Deviation 0.3286
95.00% Confidence Intervall ( 449.36 - 450.65 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51207
0.1 Scale Factor Error with Delta=300 23
0.05 Scale Factor Error with Delta=300 92
0.01 Scale Factor Error with Delta=300 2304
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Priest_Disc_T14H Priest_Disc_T14H berserking 26297 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.05sec 0 450.01sec
Priest_Disc_T14H Priest_Disc_T14H divine_aegis 0 761088 1691 11.16 9097 0 0.0 83.7 0.0% 0.0% 0.0% 0.0% nansec 0 450.01sec
Priest_Disc_T14H Priest_Disc_T14H greater_heal 2060 2157253 4794 9.26 29854 33259 69.4 69.4 35.8% 0.0% 0.0% 0.0% 6.37sec 12375671 450.01sec
Priest_Disc_T14H Priest_Disc_T14H greater_heal_divine_aegis 47753 0 0 1.39 0 0 10.4 10.4 0.0% 0.0% 0.0% 0.0% 39.50sec 365485 450.01sec
Priest_Disc_T14H Priest_Disc_T14H inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.01sec
Priest_Disc_T14H Priest_Disc_T14H inner_focus 89485 0 0 1.98 0 0 14.9 14.9 0.0% 0.0% 0.0% 0.0% 31.98sec 0 450.01sec
Priest_Disc_T14H Priest_Disc_T14H mindbender 123040 0 0 0.97 0 0 7.3 7.3 0.0% 0.0% 0.0% 0.0% 60.53sec 0 450.01sec
Priest_Disc_T14H Priest_Disc_T14H penance_heal ticks -47540 2327948 5173 26.01 10626 17841 65.2 195.1 18.3% 0.0% 0.0% 0.0% 6.94sec 8730243 450.01sec
Priest_Disc_T14H Priest_Disc_T14H penance_heal_tick_divine_aegis 47753 0 0 1.68 0 0 12.6 12.6 0.0% 0.0% 0.0% 0.0% 32.24sec 281656 450.01sec
Priest_Disc_T14H Priest_Disc_T14H power_word_shield 17 3630925 8069 18.22 26570 0 29.1 136.7 0.0% 0.0% 0.0% 0.0% 15.80sec 3692659 450.01sec
Priest_Disc_T14H Priest_Disc_T14H power_word_shield_glyph 55672 235505 523 3.88 7123 12412 29.1 29.1 18.4% 0.0% 0.0% 0.0% 15.80sec 874684 450.01sec
Priest_Disc_T14H Priest_Disc_T14H power_word_shield_glyph_divine_aegis 47753 0 0 0.23 0 0 1.7 1.7 0.0% 0.0% 0.0% 0.0% 118.81sec 29356 450.01sec
Priest_Disc_T14H Priest_Disc_T14H renew ticks -139 748101 1662 14.03 6197 11144 25.9 105.2 18.4% 0.0% 0.0% 0.0% 17.40sec 2572237 450.01sec
Priest_Disc_T14H Priest_Disc_T14H renew_divine_aegis 47753 0 0 2.59 0 0 19.4 19.4 0.0% 0.0% 0.0% 0.0% 22.14sec 95453 450.01sec
Priest_Disc_T14H Priest_Disc_T14H_mindbender melee 0 1034130 9666 49.04 11395 24327 87.5 87.5 18.4% 16.7% 6.0% 0.0% 4.51sec 1034130 106.99sec
Priest_Disc_T14H Priest_Disc_T14H_mindbender shadowcrawl 63619 0 0 12.03 0 0 21.5 21.5 0.0% 0.0% 0.0% 0.0% 19.01sec 0 106.99sec
Priest_Holy_T14H Priest_Holy_T14H berserking 26297 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.07sec 0 450.01sec
Priest_Holy_T14H Priest_Holy_T14H chakra 81208 0 0 1.99 0 0 14.9 14.9 0.0% 0.0% 0.0% 0.0% 31.21sec 0 450.01sec
Priest_Holy_T14H Priest_Holy_T14H echo_of_light ticks -77489 350892 780 40.32 1160 0 83.7 302.4 0.0% 0.0% 0.0% 0.0% 5.29sec 981405 450.01sec
Priest_Holy_T14H Priest_Holy_T14H flash_heal 2061 369574 821 3.61 11718 15706 27.0 27.0 48.8% 0.0% 0.0% 0.0% 16.08sec 3042319 450.01sec
Priest_Holy_T14H Priest_Holy_T14H greater_heal 2060 539980 1200 3.26 19768 24791 24.5 24.5 46.0% 0.0% 0.0% 0.0% 9.54sec 3593610 450.01sec
Priest_Holy_T14H Priest_Holy_T14H heal 2050 2794073 6209 19.00 15408 25016 142.5 142.5 43.7% 0.0% 0.0% 0.0% 3.14sec 9656995 450.01sec
Priest_Holy_T14H Priest_Holy_T14H holy_word_serenity 88684 481245 1069 5.27 10505 15482 39.6 39.6 33.4% 0.0% 0.0% 0.0% 11.49sec 3153378 450.01sec
Priest_Holy_T14H Priest_Holy_T14H hymn_of_hope 64901 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.01sec
Priest_Holy_T14H Priest_Holy_T14H inner_fire 588 0 0 0.13 0 0 1.0 1.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.01sec
Priest_Holy_T14H Priest_Holy_T14H renew ticks -139 1357975 3018 23.15 5699 10504 18.8 173.6 44.2% 0.0% 0.0% 0.0% 24.24sec 4564467 450.01sec
Priest_Holy_T14H Priest_Holy_T14H shadowfiend 34433 0 0 0.37 0 0 2.8 2.8 0.0% 0.0% 0.0% 0.0% 181.05sec 0 450.01sec
Priest_Holy_T14H Priest_Holy_T14H_shadowfiend melee 0 532442 16138 50.61 18471 39381 27.8 27.8 18.2% 16.7% 6.0% 0.0% 12.37sec 532442 32.99sec
Priest_Holy_T14H Priest_Holy_T14H_shadowfiend shadowcrawl 63619 0 0 10.05 0 0 5.5 5.5 0.0% 0.0% 0.0% 0.0% 72.50sec 0 32.99sec
Priest_Holy_T14H Priest_Holy_T14H_shadowfiend stormlash 120687 56 2 0.25 363 721 0.1 0.1 17.1% 5.2% 0.0% 0.0% 1.52sec 56 32.99sec
Warrior_Protection_T14H Warrior_Protection_T14H avatar 107574 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 181.31sec 0 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H battle_shout 6673 0 0 1.02 0 0 7.6 7.6 0.0% 0.0% 0.0% 0.0% 62.59sec 0 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H berserker_rage 18499 0 0 2.06 0 0 15.4 15.4 0.0% 0.0% 0.0% 0.0% 30.15sec 0 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H deep_wounds ticks -115767 9222259 20494 19.85 57864 115795 197.3 148.9 7.0% 0.0% 0.0% 0.0% 2.28sec 9222259 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H demoralizing_shout 1160 0 0 1.01 0 0 7.6 7.6 0.0% 0.0% 0.0% 0.0% 63.10sec 0 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H devastate 20243 9496329 21103 16.07 81670 163354 120.5 120.5 6.4% 9.9% 0.0% 4.2% 3.67sec 9496329 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H heroic_strike 78 1172883 2606 2.94 55188 110177 22.0 22.0 6.3% 9.8% 0.0% 4.3% 19.82sec 1172883 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H melee_main_hand 0 6846610 15214 26.65 37580 75105 199.9 199.9 7.0% 9.8% 24.0% 3.0% 2.25sec 6846610 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H revenge 6572 8822589 19605 9.23 132119 263942 69.2 69.2 6.3% 9.8% 0.0% 4.2% 6.51sec 8822589 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H shield_barrier 112048 3526312 7836 9.71 48442 0 14.7 72.8 0.0% 0.0% 0.0% 0.0% 29.25sec 5177936 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H shield_block 2565 0 0 6.73 0 0 50.5 50.5 0.0% 0.0% 0.0% 0.0% 8.92sec 0 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H shield_slam 23922 17351366 38558 10.88 220560 440818 81.6 81.6 6.3% 9.9% 0.0% 4.2% 5.54sec 17351366 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H shield_wall 871 0 0 0.48 0 0 3.6 3.6 0.0% 0.0% 0.0% 0.0% 134.28sec 0 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H stormlash 120687 1042184 2316 5.03 27784 54764 37.7 37.7 2.0% 2.4% 0.0% 0.0% 8.70sec 1042184 450.01sec
Warrior_Protection_T14H Warrior_Protection_T14H thunder_clap 6343 1112215 2472 1.92 72373 144169 14.4 14.4 7.0% 0.1% 0.0% 0.0% 32.05sec 1112215 450.01sec

Fluffy_Pillow : 21817 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
21816.7 21816.7 22.16 / 0.10% 2930 / 13.4% -1.0 0.0 0.0 None 66.09% 13.4 100.0%
Scale Factors for Fluffy_Pillow's damage taken per second
Scale Factors
Scale Deltas
Gear Ranking

Charts,s,333333&chd=t:21912|1352&chds=0,43824&chco=C79C6E,C41F3B&chm=t++21912++melee_main_hand,C79C6E,0,0,15|t++1352++spell_nuke_Warrior_Protection_T14H,C41F3B,1,0,15&chtt=Fluffy_Pillow Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:98,2&chds=0,100&chdls=ffffff&chco=C79C6E,C41F3B&chl=melee_main_hand|spell_nuke_Warrior_Protection_T14H&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:qnkhfhfkjhllliimghggnhhiimjjjiiiikjjllsmmmmuttsrxrryssxx0ttppsllhhmkkhhlffmffkkqnnssyvvvv2003380070000700004yyww2uuvv1uuyrroosllmmsnnnnvqqqrwssyuuwv0vvvv0uurrxqqqqvppuppootoonnqmljjniiggiddhccbbfbbddkhhjjpmmppvrrxuuvv1wwww3wwww1wwww1vv0vuttxqqppvpppptnnnnsnntpprrxssssyttww2xxww2ww3wwww1vvttxqqqqvqqoosllqkkkkqllllpklllqmmoouppvppqqxssttyuuvv2xxxx3xx2wwuuzuuttwqqnnrllkjokkniiggkggihmiijjpllmlmppurrttzvvww2wwvv0uuysssswqqonsmmmmrmmooupptoopptpppptoooounnnntppvqqssyuuuuzuuttyttssxrrvppppvqqrryttvv0vvvw0ww0vvuuzssrrwqqpqwrrttzuuwtvruxtwrv&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=539|1:|0|avg=21817|max=30505&chxp=1,1,72,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:12,0,8,24,24,52,40,108,80,132,184,280,328,492,532,624,828,1016,1124,1192,1304,1280,1436,1492,1400,1412,1336,1216,1248,1064,1000,700,648,568,496,344,248,244,144,132,64,52,32,24,20,0,12,0,0,4&chds=0,1492&chbh=5&chxt=x&chxl=0:|min=15514|avg=21817|max=28652&chxp=0,1,48,100&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18,s,333333&chd=t:34.0,66.1&chds=0,100&chdls=ffffff&chco=C41F3B,ffffff&chl=spell_nuke_Warrior_Protection_T14H 153.1s|waiting 297.4s&chtt=Fluffy_Pillow Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 21817
melee_main_hand 21357 97.9% 175.5 2.56sec 54780 21912 112716 0 54780 0.0% 20.2% 0.0% 21.8% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.52 175.52 0.00 0.00 2.5000 0.0000 9614645.11 9614645.11 0.00 21911.82 21911.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 9.90% 112715.55 0 247848 112406.89 12546 185987 1958744 1958744 0.00
crit-block 84.48 48.13% 47924.76 -0 155317 47927.08 32529 66815 4048584 4048584 0.00
block 38.27 21.81% 94251.19 0 209644 94078.96 55962 129067 3607317 3607317 0.00
parry 19.05 10.85% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 16.34 9.31% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Warrior_Protection_T14H
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:700000.00
  • base_dd_max:700000.00
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spell_nuke_Warrior_Protection_T14H 460 2.1% 99.7 4.54sec 2077 1352 2077 0 2077 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spell_nuke_Warrior_Protection_T14H

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.67 99.67 0.00 0.00 1.5365 0.0000 206994.88 206994.88 0.00 1351.59 1351.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.67 100.00% 2076.70 0 118367 2075.55 1346 3214 206995 206995 0.00